KEGG   Burkholderia thailandensis MSMB121: BTI_2921Help
Entry
BTI_2921          CDS       T02644                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00020  Citrate cycle (TCA cycle)
btd00480  Glutathione metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
btd01200  Carbon metabolism
btd01210  2-Oxocarboxylic acid metabolism
btd01230  Biosynthesis of amino acids
Module
btd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btd_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTI_2921 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTI_2921 (icd)
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BTI_2921 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGK48380
LinkDB All DBs
Position
1:complement(3213500..3214759)
Genome map
AA seq 419 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVEKAYG
GKKKIHWMEIYAGEKATKIYGPDVWLPEETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQDLDLYVCLRPVQYFKGVPSPVRAPEKTDMVIFRENSEDIYAGIEWAAESEQAKKLIKF
LQDEMGVKKIRFPETSGIGIKPVSTEGTERLVRKAIQYAIDNNRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGAELIDGGPWMRVKNPKTGGEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADVIIAAMEKSIQQKRVTYDFARLMEGATQVSCSGFGQVLIENMQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggtcccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcatcccttacatcgagggcgacggcacgggc
ttcgacatcacgccggtgatgatcaaggtcgtcgacgcggcggtcgagaaggcgtacggc
ggcaagaagaagatccactggatggagatctacgccggcgagaaggcgacgaagatctac
ggcccggacgtgtggctgccggaagagacgctgcaggtgctgaaggaatacgtcgtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgctcgctgaacgtcgcgctg
cgccaggatctcgacctgtacgtctgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgcgcgccggaaaagaccgacatggtgatcttccgcgagaactcggaagac
atctacgccggcatcgaatgggctgccgaatccgagcaggcgaagaagctcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacgtcgggcatcggcatc
aagcccgtgtcgacggaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacaaccgcaagtcggtcacgctcgtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgcgggctacgcgctcgcgcagaaggaattcggcgccgagctgatc
gacggcggcccgtggatgcgcgtcaagaacccgaagacgggcggcgagatcgtgatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgtccggccgagtacgacgtg
atcgcgacgctgaacctgaacggcgactacatctcggacgcgctcgccgcgcaagtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaagccacg
cacggcacggcgccgaagtacgccggcaaggactacgtgaacccgggttcggaaatcctg
tcggccgaaatgatgctgcgccacctcggctggaccgaagcggccgacgtcatcattgcc
gcgatggaaaagtcgatccagcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaagtgtcgtgctcgggcttcggtcaggtgctgatcgaaaacatgcagtaa

DBGET integrated database retrieval system