KEGG   Burkholderia thailandensis MSMB121: BTI_3389Help
Entry
BTI_3389          CDS       T02644                                 

Definition
(GenBank) glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BTI_3389
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btd02000]
    BTI_3389
Enzymes [BR:btd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BTI_3389
Transporters [BR:btd02000]
 Other Transporters
  Pores ion channels [TC:1]
   BTI_3389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2
Motif
Other DBs
NCBI-ProteinID: AGK47140
LinkDB All DBs
Position
1:complement(3747463..3748101)
Genome map
AA seq 212 aa AA seqDB search
MSSYRLYYSPGACSLAAHIALEETGAPFDAEPVRLSHREHLGERYLAINPKARVPALAIS
GEARVLTETPAILTYLARRHPDAALLPIDDPLREARCHEWLAWLVGWVHGVGYGALWRPG
RFAGDESIHPAISAHARRVIDEANGAIDAALRDGRQWAEPGGYSIVDPFLLVLYRWGGAI
GLDMGRRDAWGEHAARVSARDAAKRALATEGL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttatcgactctactattcgccgggcgcgtgctcgctcgccgcgcacatcgcg
ctcgaggaaaccggtgcgccgttcgatgccgagccagtgcgcctgtcgcatcgcgagcat
ctcggcgagcgttatctcgcgatcaatccgaaggcgcgcgtgcccgcgctcgcgatttcc
ggcgaagcgcgcgtgctgaccgagacgcccgcgatcctcacctatctcgcgcgccggcat
ccggacgccgcgctgctgccgatcgacgatccgctgcgcgaggcgcgttgccatgaatgg
ctcgcgtggctcgtcggctgggtgcacggcgtcggttacggcgcgctgtggcggccgggg
cggttcgccggcgacgaatcgattcatccggcgatctccgcgcacgcaaggcgcgtgatc
gacgaagcgaacggcgcgatcgacgcggcgctgcgcgacgggcggcaatgggcggagccg
ggcgggtattcgatcgtcgatccgttcctgctcgtgctgtatcggtgggggggcgcgatc
gggctcgacatgggtcgacgcgatgcgtggggcgagcatgcggcgcgcgtctctgcgcgc
gatgcggcgaagcgggcgctcgcgacggaggggctgtag

DBGET integrated database retrieval system