KEGG   Burkholderia thailandensis MSMB121: BTI_4288Help
Entry
BTI_4288          CDS       T02644                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
btd  Burkholderia thailandensis MSMB121
Brite
KEGG Orthology (KO) [BR:btd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BTI_4288 (ahpF)
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BTI_4288 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 Glutaredoxin DAO FAD_oxidored Thi4 HI0933_like K_oxygenase FAD_binding_3 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGK50076
LinkDB All DBs
Position
2:864564..866171
Genome map
AA seq 535 aa AA seqDB search
MLDANLKTQLKSYLERITRPVELVASLDDGGQSRELRALLDEIASLSPQVSIVERRDGAK
RTPSFSVGEPGKAAGIRFAGMPMGHEFTSLVLALLQTGGHPIKLDDATIEQIRALDGDYA
FETYISLTCQNCPEVVQALNVMALVNPRIRHVMIDGALFQDEVEARRIMAVPTIFLNGET
FGQGRSSVKEILAKLDRGASRRAAQALAEKPVFDMLIVGGGPAGAAAAIYAARKGILTGV
VAERFGGQVLDTMAIENFVSVKETEGPKFATALEQHVKQYEVDVIDVQRADRLVPGRIHE
IRLASGAVLKAKAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADDVLQRKLHSLANVTVLTRARTTELTGDGARL
NGLVYEDMRTGEAKRIALEGVFVQIGLVPNAEWLRGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPYKQIVIAVGEGAKASLGAFDYLIRSEADAAQAADAEASASAEMIAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatctcaagactcagttgaaatcgtacctcgaacggatcacgcgtccc
gtcgagctcgtcgcatcgctcgacgacggcggccagtcgcgcgagctgcgtgcgctgctc
gacgagatcgcgtcgctttcgccgcaagtctcgatcgtcgagcgccgcgacggggccaag
cgcacgccgtcgttctcggtcggcgagccgggcaaggccgcgggcatccgcttcgccggg
atgccgatgggccatgagttcacgtcgctcgtgctcgcgctgctgcagacgggcggccat
ccgatcaagctcgacgacgcgacgatcgagcagatccgcgcgctcgacggcgattacgcg
ttcgagacgtacatctcgctcacctgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcgtcaacccgcgcatccgccacgtgatgatcgacggcgcgctgttccag
gacgaagtcgaggcgcgccggatcatggccgtgccgacgatcttcctgaacggcgagacg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgaccgcggcgcgagc
cggcgcgcggcgcaggcgctcgcggaaaagcccgtgttcgacatgctgatcgtcggcggc
ggccccgccggcgcggcggccgcgatctacgcggcgcgcaagggcatcttgacgggcgtc
gtcgccgagcgcttcggcgggcaagtgctcgacacgatggcgatcgagaacttcgtgtcg
gtcaaggaaaccgaagggccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacgtgatcgacgtgcagcgcgccgaccggctcgtgccgggccgcatccacgaa
atccgcctcgcgagcggcgcggtgctgaaggcgaaagccgtcgtgctcgccaccggcgcg
cgctggcgcgaaatcggcgtgcccggcgagcgcgagtatcgcaaccgcggcgtcgcgtac
tgcccgcattgcgacggcccgcttttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggctgcgatcgatctcgccggcatcgtgagcgaagtgacgctgatc
gaatacggcgcgcaactgcgcgcggacgacgtgctgcagcgcaagctgcacagcctcgcg
aacgtgacggtgctcacgcgtgcccgcacgaccgaactcacgggcgacggcgcgcggctg
aacgggctcgtctacgaggacatgcgcaccggcgaagcgaagcgcatcgcgctcgaaggc
gtgttcgtgcagatcggcctcgtgccgaacgccgaatggctgaggggaacggtcgagctg
tcgaagcacggcgagatcgtcgtcgacgcgcgcggcgcgacgtcggtgcccggcgtgttc
gccgccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcgttcgactatctgattcgaagcgaagcggatgcggcgcag
gcggcggatgccgaagcctcggcgagcgccgagatgatcgccgcctga

DBGET integrated database retrieval system