KEGG   Burkholderia thailandensis MSMB121: BTI_4631
Entry
BTI_4631          CDS       T02644                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
btd  Burkholderia thailandensis MSMB121
Brite
KEGG Orthology (KO) [BR:btd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btd02044]
    BTI_4631
Secretion system [BR:btd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BTI_4631
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AGK50749
LinkDB
Position
2:1301346..1302692
AA seq 448 aa
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKI
IVKSASGVFADGTPFDAPGSTPPPAPLTIRPEHLDQVIHLAVPIRVPNGEETAFGHAAES
LARYAVFETDLRDTNSIGQGPKTVQLSNLRLRLIPEKELTDAWIGLALTRVKTIRADASI
ELDDTLIPPVVGYGASDTLASWLAKIHDLTRLRANALAERLTGADGRAGTTAEVSDYLLL
QTLNRYEPLLQHLQRVPTTSPADLYALLIGMAGELSTYVRTDTRRPLDTHPPYQHVAPHL
CLKPVVDDAHRLLNAVLVRSAQSIALADQGHGMLNAVVDPVDMQGFTAVVLAVHAQMPPD
LLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPRQIPFNAGYVYYELARSGPLWD
EVARHGGLALHIAGEFPSLKLELWGIRG
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagctggcataacaaggtcgtctggagcgaggggctcttcatgcgcccgcagttgttc
cagcagcaggagcgctacctcgagcactacgcgcacaagcgcgcggcgccgctgtcgccg
ttcttcttcggcttcagccacttcagcctcgacagcgaggcgccggcgctcggcaagatc
atcgtgaaatcggcgagcggcgtgttcgccgacggcacgccgttcgacgcgccgggcagc
acgccgccgcccgcgccgctcacgatccggcccgagcacctggaccaggtgatccatctc
gcggtgccgatccgcgtgccgaacggcgaggagaccgcattcggccacgcggccgaatcg
ctcgcgcgctacgccgtgttcgaaaccgatctgcgcgacacgaactcgatcgggcaaggg
ccgaagaccgtccagttgtcgaacctgcgcctgcggctgattccggaaaaggaactgacg
gacgcgtggatcgggctcgcgctcacgcgcgtgaagacgatccgcgcggacgcgagcatc
gagctcgacgacacgctgattccgcccgtggtcggctacggcgcgagcgacacgctcgcg
agctggctcgcgaagatccacgatctcacgcgcctgcgcgcgaacgcgctcgccgagcgc
ctgacgggcgcggacggccgggcgggcacgacggccgaagtgtccgactacctgctgctg
cagacgctcaatcgctacgagccgctgctgcaacacctgcagcgcgtgccgacgacgtcg
cccgccgatctgtacgcgctcctcatcggcatggcgggcgagctgtcgacctacgtgcgc
accgacacgcgccggccgctcgatacgcatccgccgtatcagcacgtcgcgccgcacctg
tgcctgaagcccgtcgtcgacgatgcgcaccggctgctcaacgccgtgctcgtgcgcagc
gcgcagagcatcgcgctcgccgatcaggggcacgggatgctcaatgcggtcgtcgatccg
gtcgacatgcagggcttcaccgcggtcgtgctcgcggtgcacgcgcagatgccgcccgat
ctgttgcagcagcagttcgccgcgcaggcgaaggcggggccgtccgagcggctgccggac
ctcgtgcgcagccatctgtcaggcatcgcgctgcaggcgctgccggtgccgccccggcag
attccgttcaacgccggctacgtctactacgagctcgcgcgaagcggaccgctgtgggac
gaagtggcgcggcacggcgggctcgcgttgcacatcgccggcgaatttccgtcgctgaag
ctggagctgtggggcattcgcggatag

DBGET integrated database retrieval system