KEGG   Burkholderia thailandensis MSMB121: BTI_4648Help
Entry
BTI_4648          CDS       T02644                                 

Gene name
ga1
Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00500  Starch and sucrose metabolism
btd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTI_4648 (ga1)
Enzymes [BR:btd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BTI_4648 (ga1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N CBM_20 Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AGK51646
LinkDB All DBs
Position
2:1324144..1326789
Genome map
AA seq 881 aa AA seqDB search
MSAKHFGFKQAMLVGSLAALAGAALPPANASAAEAFGSPGATPVRGPSAKSFLGTAVGGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKLQAYSAAQTDARTMSW
QVTTSNSSHNWQIRKTVFADPNYNAIVQRVTFTALNGHKVGDFNLYMLSKPYLDNAGGNN
TAQTVSSSGGTALVANHNSRYSALVASRPWKVVNGAGMTSNGFVGQSDGWTDLLGGNADK
TMDWTFSSATNGNVAQMGWIDLGDPGATSVSFDIVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTAWHTYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDSN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNASGCAQGYS
RIGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIAAQNGDTASAARYLAAADYWQENVAAWTYT
SSGTFGSGSYYIRINPAGRAGAGTDRASFAPTAGPDTPQTLTVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIVNTILVYDSVLGQTLSIANAPTLSPNAWFRYNFDGYGEHNDGSD
FDGTGAGRLWPIFTAERGMVEIARQGSGNAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYAPGQPTKSMAPLNWAMGEYISLLASIQAGRIADVPSVVCARYSNCVAPL
QSGQVSVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPARYPVWSNTVNMPAGQA
IQYKYYRKNADGSVTWENWSGNRALQTPASGTLTLNDQVNW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaagcacttcggattcaaacaggcgatgctggttggcagtctggccgcgctc
gcgggcgcggcgctcccgccggcgaatgcttcggctgccgaagcatttggctcgcccggc
gcgacgcccgtgcgcggtccctcggccaagtcgttcctcggcacggcggtcggcggcgcg
tcgcgggtctacttcaccggctatcgcggcattctgtccgaggtctactatccggttctc
gacacgccggagtccgtcgacctgcagttcctcgtcggcgatgccggcaagaccttcgtc
gacgaagaaaagctgcaggcctactcggccgcgcaaacggacgcgcgcacgatgagttgg
caggtgacgaccagcaacagttcgcataactggcaaatccgcaagaccgtcttcgccgat
ccgaactacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccacaaggtc
ggcgacttcaatctctacatgctgtcgaagccgtacctcgacaacgccggcggcaacaac
accgcgcaaacggtgtccagcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaagtggtcaacggcgccggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaacgccgacaag
acgatggactggacgttctcgtccgcgaccaacggcaacgtcgcgcagatgggctggatc
gatctcggcgatccgggcgcgacgagcgtgtcgttcgacatcgtgctcggcttcggcggc
acgcaggatcaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgcgtggcacacctacgcggcgggcctgtcgtcgcagaacggc
gcggcggacgacggctactatctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgattcgaac
gcgggcggctatcacctcgtatggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggccggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctgcag
caaacgacggactgcggcaccgccgaatacaacgcatccggctgcgcgcagggctacagc
cgcatcgggcgcttcccgcagaacgcgtgggtgaacggctggccgtactggcaaggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgttgtggccgaagatcaagctcaccgccgactacatcgtcaacaccggcccgtgg
acgtaccaggagcgctgggaagagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcagccgacatcgccgcgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcacgttcggcagcggcagctactacatccggatcaatccggcgggccgcgcg
ggcgccggcaccgatcgcgcgagcttcgcgcccaccgcgggcccggacacgccgcagacg
ctgaccgtgaagaacggcggcggcagccacgatgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggcgtcaagcgcgcgaccgatccgacgatcgtcaacacgatc
ttggtctacgacagcgtgctcggccagacgctgagcatcgcgaacgcgccgacgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcagcgac
ttcgacggcaccggcgccggccgactgtggccgatcttcaccgccgagcgcgggatggtg
gagatcgcgcgccagggcagcggcaacgcgggcagcgcgtacttctcgacgctcaagcaa
ctgacgacgcccgagggcttcgtgccggagcaggtatggtcgaattcgacgacgctgccc
gacggctgggcagtgacgacgcccgccggctacgcgccggggcagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgagtacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgccgacgtgccgtcggtggtctgcgcgcgctacagcaactgtgtcgcgccgctg
cagagcgggcaggtgtcggtggcggtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacgggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgacccggcccgttacccggtgtggagcaataccgtcaacatgccggccggtcaggcg
atccagtacaagtactatcggaaaaacgcggacggcagcgtgacgtgggagaactggtcg
ggcaaccgagcgcttcagacgcccgcgagcggcacgttgacgctgaacgatcaggtgaac
tggtga

DBGET integrated database retrieval system