KEGG   Burkholderia thailandensis MSMB121: BTI_5102Help
Entry
BTI_5102          CDS       T02644                                 

Definition
(GenBank) ring hydroxylating alpha subunit family protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00627  Aminobenzoate degradation
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
Module
btd_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_5102
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BTI_5102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: AGK50831
LinkDB All DBs
Position
2:1859936..1861213
Genome map
AA seq 425 aa AA seqDB search
MDPTESPVILIDHTDSSDVRFPHDDGSRVPYKVFSSQAVYDREQERIFRGQTWNFVALEA
EIPKPGDFKSTFVGDTPVVVTRREDGALAAWVNRCAHRGAQVCRKARGNASSHTCVYHQW
SFDSQGNLLGVPFRRGQKGMAGMPADFDPKNHGLRKLQVDSYKGLVFATFSDTVAPLPDY
LGAQMRPWIDRIFHKPIEYLGCTRQFSKSNWKLYFENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITMTKTRDDADTATAYKQQNIRSFDEGFSLEDDSILALVSEYDE
DTTNHIQPIFPQLVIQQIHNTLVARQLLPKGPKNFELIFHFFGYADDTPELRDLRIRQAN
LVGPAGYISMEDTEATELVQRGTVRDAHAASVIEMSRGNPDQQDTAITESLIRKFWVGYQ
QLMGY
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacccgaccgaatctccagtgatactgatcgatcacaccgattcgtccgacgtgcga
ttcccgcacgacgacggctcgcgcgtgccgtacaaggtgttcagctcgcaagcggtgtac
gaccgcgagcaggagcgaatcttccgcgggcagacgtggaatttcgtcgcgctcgaagcg
gaaatcccgaagccgggcgacttcaagagcacgttcgtcggcgatacgcccgtcgtcgtc
acgcgccgcgaggacggcgcactcgccgcgtgggtgaaccgctgcgcgcatcgcggcgcg
caggtgtgccgcaaggcgcgcggcaacgcaagctcgcacacgtgcgtatatcaccaatgg
agcttcgacagccaaggcaacctgctcggcgtgccgttccggcgcggccagaagggcatg
gccggaatgcccgcggatttcgatccgaaaaaccacgggctgcgcaagctgcaagtcgac
agctacaagggcctcgtgttcgcgacgttcagcgacaccgtcgcgccgctacccgattac
ctcggcgcgcaaatgcggccgtggatcgaccggatcttccacaagccgatcgagtatctc
ggctgcacacggcagttctcgaaatcgaactggaagttgtacttcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgacgttcaacatcttccgcgtcggg
atgaaggcgcgttcgatcccggacgcgacgcacgggctgcacagcatcatcacgatgacg
aagacgcgcgacgacgcggacaccgcgaccgcgtacaagcagcagaacatccgttcgttc
gacgaaggtttttcgctcgaggacgattcgatcctcgcgctggtatccgaatacgacgaa
gacacgacgaatcacatccagccgatcttcccgcagctcgtgatccagcagatccacaac
acgctcgtcgcgcgccaactgctgccgaaggggccgaagaacttcgagctgatcttccac
ttcttcggctacgcggacgacacgcccgagctgcgcgatttgcggatcaggcaggcaaac
ctcgtcgggcccgccggctatatctcgatggaggacaccgaggcgaccgagctcgtccag
cgcggcaccgtgcgcgatgcgcacgcggcgtcggtgatcgagatgtcgcgcggcaatccg
gaccagcaggacacggcgatcaccgaaagcctgatccgcaagttctgggtcggctaccag
cagttgatgggctattga

DBGET integrated database retrieval system