KEGG   Burkholderia thailandensis MSMB121: BTI_5103Help
Entry
BTI_5103          CDS       T02644                                 

Definition
(GenBank) ring hydroxylating beta subunit
  KO
K16320  anthranilate 1,2-dioxygenase small subunit [EC:1.14.12.1]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00627  Aminobenzoate degradation
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
Module
btd_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_5103
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     BTI_5103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Motif
Other DBs
NCBI-ProteinID: AGK50082
LinkDB All DBs
Position
2:1861228..1861725
Genome map
AA seq 165 aa AA seqDB search
MTGITDDITDDIRTWFELHLLQDRYIGHLDNDRLERWPELFTEDCLYEIVPKENADLGLP
IGIVHCTNRRMLRDRVVSLRHANIYEAHTYRHLTSGLAIVGGQDGEIETESSYVVVQTRS
DGESNVYQAGKYYDTVVRTAAGLRYRKKRVIYDTSRVQTLLATPI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcatcaccgacgacatcaccgacgacattcgcacgtggttcgagctgcacctg
ctgcaggaccgctacatcggccatctcgacaacgaccgcctcgagcgctggccggagctc
ttcaccgaagactgcctgtacgagatcgtcccgaaggaaaacgcggacctggggctgccg
atcggcatcgtccactgcacgaaccggcgaatgctgcgcgatcgcgtcgtgtcgctgcgc
cacgcgaacatctacgaggcgcacacgtaccggcacctgacgtccgggctcgcgatcgtc
ggcggccaggacggcgagatcgagaccgagagcagctacgtcgtcgtgcagacgcgcagc
gacggcgaatcgaacgtctaccaggcgggcaagtattacgacacggtcgtgcgcacggcc
gcagggttgcgctacaggaagaagcgcgtgatttacgacacgtcgcgcgtgcagacgctg
ctcgcgacgccgatctga

DBGET integrated database retrieval system