KEGG   Burkholderia thailandensis MSMB121: BTI_5104Help
Entry
BTI_5104          CDS       T02644                                 

Gene name
ndoA
Definition
(GenBank) naphthalene 1,2-dioxygenase system ferredoxin subunit
  KO
K18248  anthranilate 1,2-dioxygenase ferredoxin component
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00627  Aminobenzoate degradation
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
Module
btd_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_5104 (ndoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Rieske_2
Motif
Other DBs
NCBI-ProteinID: AGK51326
LinkDB All DBs
Position
2:1861746..1862075
Genome map
AA seq 109 aa AA seqDB search
MSQETVAAWHPLGALDEFSEGEPAARAVGNRPIAVFRLGDDVFALHDLCTHGHARLSEGF
AENGCVECPLHQGLFDIRTGAPKCAPVTEPVRVYPVRIVDGRVEIHVDE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggaaaccgtcgccgcatggcatccgctcggcgcactcgacgaattctcggag
ggcgagccggccgcgcgcgccgtcggcaacaggccgatcgcggtgttccggttgggcgac
gacgtgttcgcgctgcatgacctgtgcacgcacggacacgcacggctgtccgaaggattc
gccgagaacggctgcgtcgagtgtccgctgcatcaggggctcttcgacatccgcaccggc
gcgccgaaatgcgcgccggtgacggagcccgtgcgcgtgtatccggttcgcatcgtcgac
ggtcgggtcgagatccatgtcgacgaatga

DBGET integrated database retrieval system