KEGG   Burkholderia thailandensis MSMB121: BTI_5105Help
Entry
BTI_5105          CDS       T02644                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase family protein
  KO
K18249  anthranilate 1,2-dioxygenase ferredoxin reductase component [EC:1.18.1.-]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00627  Aminobenzoate degradation
btd01100  Metabolic pathways
btd01120  Microbial metabolism in diverse environments
Module
btd_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTI_5105
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.-  
     BTI_5105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox XdhC_C 3HCDH_N AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGK50031
LinkDB All DBs
Position
2:1862062..1863306
Genome map
AA seq 414 aa AA seqDB search
MSTNDPYLIAGGGHAARRAVETLRERDPAARIVMIGAEPELPYDRPALSKDALVGGDEGE
RRAFVRDAAWYRERDIALRLGVRVEAIERRAQRVRLSDGASLGYARLLIATGSRVRRFAG
PVDAGVAVHYVRTVADARALRAALAPGKRVAVLGGGFIGLEVAASAVRLGCRATIVEPAP
RLLQRAMPEAVGAFALALHARHGVDVRLGALPERIRRGANGMAVVETSAGGIAADVVVAG
IGIVPNVELAQAAGLPVDDGIRVDERCCTADAAIFAAGEVTRHFNPLVGRHLRIESWQIA
ENQPAVAAANMLGGDEAYAQWPWLWSDQYDCNLQTLGLFDGGQTLVLRGSPERDRAFCVF
GLNARRELRAVAAVNAGREIAGCRRLMTANVALDPACLADPSVALRSMLRGGAQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaatgatccgtatctgatcgcgggcggcgggcacgcggcgcgccgcgcggtc
gagacgctgcgcgagcgcgatcctgccgcgcgcatcgtgatgatcggcgcggagcccgag
ctgccgtacgaccggcccgcgttgtcgaaggacgcgctcgtcggcggcgacgaaggcgag
cgccgcgcgttcgtgcgcgacgccgcgtggtatcgcgagcgcgacatcgcgctgcggctc
ggcgtgcgcgtcgaggcgatcgagcgccgcgcgcagcgggtgcgcctgagcgacggcgcg
agcctcggctacgcgcggctgttgatcgcgaccggttcgcgcgtgcggcgcttcgccgga
ccggtcgacgccggcgtggccgtccactacgtgcgcacggtcgccgacgcccgcgcgctg
cgcgcggcgctcgcgccgggcaagcgcgtcgcggtgctgggcggcggcttcatcgggctc
gaggtcgccgcgtcggcggtgcggctcggctgccgcgcgacgattgtcgagcccgcgcca
cggctgcttcagcgcgcaatgcccgaggccgtcggcgcgttcgcgctcgcgctgcatgcg
cggcacggcgtcgacgtgcggctcggcgcgctgccggagcgcatccgccgcggcgcgaac
ggcatggccgtcgtcgaaacgagcgcgggcgggatcgcggccgacgtcgtcgtggccggc
atcggcatcgtgccgaacgtcgagctcgcgcaggcggcgggccttcctgtcgacgacggc
atccgcgtcgacgagcggtgctgcaccgccgatgcggcaatcttcgcggcgggcgaggtc
acgcggcatttcaacccgctcgtcggccggcatttgcggatcgagtcatggcagatcgcc
gagaaccagccggccgtcgccgcggcgaacatgctcggcggcgacgaggcctacgcgcaa
tggccgtggctgtggtccgatcagtacgactgcaacctgcagacgctcgggctcttcgac
ggcgggcagacgctcgtgttgcgcggctcgcccgagcgcgaccgcgcattttgcgtgttc
gggctgaacgcgcgccgggagctgcgggcggtcgcggccgtcaacgcggggcgcgagatc
gccgggtgccggcgcttgatgacggcgaacgtcgcgctcgatcccgcgtgtctcgcggac
ccgtcggtcgcgttgcgctcgatgctgcggggcggcgcgcaatga

DBGET integrated database retrieval system