KEGG   Burkholderia thailandensis MSMB121: BTI_5338
Entry
BTI_5338          CDS       T02644                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00440  Phosphonate and phosphinate metabolism
btd00998  Biosynthesis of various secondary metabolites - part 2
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BTI_5338 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BTI_5338 (aepX)
Enzymes [BR:btd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BTI_5338 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Other DBs
NCBI-ProteinID: AGK50482
LinkDB
Position
2:complement(2158407..2160095)
AA seq 562 aa
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGKGLEAVTEDKPKVMLPIAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERMTGDTIVSYGDLLFRSYILRDLAESEAE
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKALLRRVSSDASEAGPHGRWIGLLNV
RGAGVARLKAMLDTLKARDDFDALDLPALLNALIDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGNGDAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcggatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgataccggctacggcaacttcaacaac
gtgcgccggctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtattacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtcggcgtccgcgatgcaggcggtcgcgcgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggagcgcgtcgcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcggatctatctgtcgtcgagc
gcgcgcgcgtcgagtgcggcgctcgtgctcgcggcgagccgcggcaaggggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccgatcgccggcaagcctctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctatcgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcatgcgcaaacg
ggcgagctcgcgtcgctcgcgtgcgcggccgagcgcatgacgggcgacaccatcgtctcg
tacggcgatctgctgttccgcagctacatcctgcgcgatctcgcggagagcgaggcggag
ttcagcgtcgtcgtcgactcgtcgcagacgcagccgtcgaaccagagcgtgcgcgacttc
gcgttctgctcggccgccgacgaccgcgggctgttcggccagaaggcgcttctgcgccgc
gtgtcgagcgacgcgagcgaagccgggccgcacggccgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcgacacgctgaaggcgcgcgacgat
ttcgatgcgctcgatctgccggcgctcctgaacgcgctcatcgacgcgggcgagcagatc
gaggtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgatttcgcgcacggccagacgccgtatgcggagcagaacgcgggcaacggggac
gcgcgatga

DBGET integrated database retrieval system