KEGG   Burkholderia thailandensis MSMB121: BTI_5339Help
Entry
BTI_5339          CDS       T02644                                 

Definition
(GenBank) nucleotidyl transferase family protein
Organism
btd  Burkholderia thailandensis MSMB121
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_3 NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: AGK51163
LinkDB All DBs
Position
2:complement(2160092..2160859)
Genome map
AA seq 255 aa AA seqDB search
MRAIILAAGLGLRLQLPPEAQFPKCLLRFDDTSLLERHLRVLDAAGVDEIVLALGFQSEK
VEAELARLNRRAEIVLNPRYDLGSVLTVHTAAGALTRGGDVLLMDADVLYDDAILHALVA
DPSRAIDRLLIDRDFETGDEPVKLCVKDGVPVELRKQLAAGLEYDTIGESVGFFRFSEGA
ARRLAEIVAGYVDGGRANMPHEEAVRDLLLEGGRTFDIADVTGSPWIEIDFPGDVARARD
EVLPHIQQRTIGAIR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccatcattcttgcggcgggcctaggcctgcgcctgcaactgcctcccgaggct
caattcccgaagtgcctgctgcgcttcgacgacacgtcgctcctcgagcggcacctgcgc
gtgctcgacgcggcgggcgtcgacgagatcgtgctcgcgctcggcttccagtccgagaag
gtcgaggccgagctcgcgcggctgaaccgcagggccgagatcgtgctcaacccgcgctac
gacctcggcagcgtgctgaccgtccacacggccgccggcgcgctcacgcgcggcggcgac
gtgctgctgatggacgccgacgtgctctacgacgacgccatcctgcacgcgctcgtcgcc
gatccgtcgcgcgcgatcgatcgcctgctgatcgaccgcgatttcgaaacgggcgacgag
cccgtcaagctgtgcgtgaaggacggcgtgccggtcgagctgcgcaagcagctcgccgcg
ggcctcgaatacgacacgatcggcgaatcggtcggcttcttccgcttcagcgaaggcgcc
gcgcggcggctcgccgagatcgtcgcgggctacgtcgacggcggccgcgcgaacatgccg
cacgaagaggcggtgcgcgacctgctgctcgaaggcggccgcacgttcgacatcgcggac
gtgacgggctcgccgtggatcgaaatcgactttccgggcgacgtcgcgcgcgcgcgcgac
gaagtcctgccgcacatccaacaacgcacgataggggccatccgatga

DBGET integrated database retrieval system