KEGG   Burkholderia thailandensis E264: BTH_I1120Help
Entry
BTH_I1120         CDS       T00311                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00473  D-Alanine metabolism
bte00550  Peptidoglycan biosynthesis
bte01100  Metabolic pathways
bte01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTH_I1120
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTH_I1120
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BTH_I1120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bte01011]
    BTH_I1120
Enzymes [BR:bte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTH_I1120
Peptidoglycan biosynthesis and degradation proteins [BR:bte01011]
 Precursor biosynthesis
  Amino acid ligase
   BTH_I1120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp TTL ATP-grasp_3 ATP-grasp_4 ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ABC38181
UniProt: Q2SZI1
LinkDB All DBs
Position
I:1265379..1266317
Genome map
AA seq 312 aa AA seqDB search
MSGIDPKRFGKVAVLLGGESAERDVSLNSGRLVLQGLRDAGIDAHPFDPAQRPLAALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGIPTPP
FETVMRGDDYAARAKDIVAKLGMPLFVKPASEGSSVAVEKVKSADALPAALEEAAKHDKI
VIVEKSIEGGGEYTACIAADLDLPLIKIVPAGEFYDYHAKYIANDTQYLIPCGLDAAKEA
EFKRIARRAFDVLGCTDWGRADFMLDAAGNPYFLEVNTAPGMTDHSLPPKAARAVGISYS
ELVVKVLSLTLD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcggtgctgctcggcggggaatcc
gccgagcgcgatgtgtcgctgaactccggccggctggtgctgcagggcttgcgcgacgca
ggcatcgacgcgcatccgttcgatccggcgcagcggccgctcgctgcgctcaaggacgaa
ggcttcgtgcgcgcgttcaacgcgttgcacggcggttacggcgagaacggtcagatccag
ggcgcgctcgatttctacggcatccgctacacgggcagcggcgtgctcggctcggcgctc
gggctcgacaagttccgcacgaagctcgtctggcagcagacgggcattccgacgccgccg
ttcgagacggtgatgcgcggggacgactacgcggcgcgcgcgaaggacatcgtcgcgaag
ctcggcatgccgctcttcgtgaagccggcgagcgagggctcgagcgtcgcggtcgagaag
gtgaaaagcgccgatgcgttgcccgccgcactggaagaagcggcgaagcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccgccgat
ctcgatttgccgctcatcaagatcgtgcctgcgggcgagttctacgactatcacgcgaag
tacatcgcgaacgacacgcaatatctgattccgtgcggcctggatgcggcaaaggaagcc
gagttcaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcacggattgggggcgc
gcggatttcatgctcgatgccgcaggcaacccgtatttcctcgaagtgaacaccgcgccg
gggatgaccgatcactcgctgccgccgaaggcggcgcgcgcggtcggcatcagctattcg
gagctggtggtgaaagtgctgtcgctcacgctcgattga

DBGET integrated database retrieval system