KEGG   Burkholderia thailandensis E264: BTH_I2038Help
Entry
BTH_I2038         CDS       T00311                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00061  Fatty acid biosynthesis
bte00780  Biotin metabolism
bte01100  Metabolic pathways
bte01212  Fatty acid metabolism
Module
bte_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bte00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BTH_I2038 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BTH_I2038 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bte01004]
    BTH_I2038 (fabZ)
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BTH_I2038 (fabZ)
Lipid biosynthesis proteins [BR:bte01004]
 Fatty acid synthase
  Component type
   BTH_I2038 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ABC39413
UniProt: Q2SWY7
LinkDB All DBs
Structure
PDB: 

Position
I:2310497..2310979
Genome map
AA seq 160 aa AA seqDB search
MRRTIMSTEKINFDIHKILTLLPHRYPILLVDRVLELEPHKSIKALKNVTVNEPFFTGHF
PKRPVMPGVLIIEALAQAAALLTFAEAEPKDPENTLYYFVGIDNARFKRVVEPGDQLILN
VTFERYIRGIWKFKAVAEVDGKVAAEAELMCTVKTADAAP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgaaccatcatgagcactgaaaaaatcaacttcgacattcacaagatcctcacg
ctgctgccgcaccggtatccgattctgctcgtcgatcgcgtgctcgaactcgaaccgcac
aagtccatcaaagcgttgaagaacgtgacggtcaacgagccgttcttcaccggccacttc
ccgaagcggccggtgatgccgggcgtgctgatcatcgaagcgctcgcgcaggcggccgcg
ctcctcacgttcgccgaggcggagccgaaggatccggagaacacgctgtattacttcgtc
ggcatcgacaacgcgcgcttcaagcgcgtcgtcgagccgggcgatcaactgatcctgaac
gtgacgttcgagcgctatattcgcggcatctggaagttcaaggccgttgcggaagtggac
ggcaaggtcgcggcggaagccgagctgatgtgcacggtcaagacggccgacgcggcgccc
tga

DBGET integrated database retrieval system