KEGG   Burkholderia territorii: WS51_00035Help
Entry
WS51_00035        CDS       T04843                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
btei  Burkholderia territorii
Pathway
btei00260  Glycine, serine and threonine metabolism
btei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS51_00035 (tdh)
Enzymes [BR:btei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     WS51_00035 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 Pyr_redox_3 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AOI62091
UniProt: A0A104P681
LinkDB All DBs
Position
2:8120..9148
Genome map
AA seq 342 aa AA seqDB search
MKALAKLERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQKTIPVPMH
VGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAGRRHLCRNTIGVGVNREGA
FAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSFNLVGEDVLITGAGPIGIMAV
AIAKHVGARNVVITDINDYRLELARKMGATRAVNVARESLRDVMADLHMTEGFDVGLEMS
GVPSAFTSMLEAMNHGGKVALLGIPPAQTAIDWNQVIFKGLEIKGIYGREMFETWYKMVA
MLQSGLDLSPIITHRFAADDYEKGFAAMLSGESGKVILDWTV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactggcaaagctcgagcgcggccccggcctcacgctcacgcgcgtgaagcgc
cccgaagtcggacacaacgacgtgctgatcaagattcgccgcacggcgatctgcggcacc
gacatccatatctggaagtgggacgactgggcgcagaagacgattcccgtaccgatgcac
gtcggccacgaatacgtcggcgagatcgtcgagatggggcaggaagtgcgcggcttcgcg
atcggcgatcgcgtgtccggcgaaggccacatcacgtgcggcttctgtcgcaactgtcgc
gccggccgccggcatttgtgccgcaacacgatcggcgtcggcgtgaatcgcgagggcgcg
ttcgccgagtacctggcgattcccgctttcaacgcgttcaagattccgcccgagatctcc
gacgatctcgcgtcgatcttcgatccgttcggcaatgcgacgcacacggcgctgtcgttc
aatctcgtcggcgaggacgtgctgatcaccggcgcgggcccgatcggcatcatggccgtc
gcgatcgcgaagcacgtcggcgcgcgcaacgtcgtgatcaccgacatcaacgattaccgg
ctcgaactcgcgcgcaagatgggcgcgacgcgcgcggtcaacgtcgcacgcgagtcgttg
cgcgacgtgatggccgacctgcacatgacggaaggcttcgacgtcggccttgagatgtcg
ggcgtgccgagcgcgttcaccagcatgctcgaggcgatgaatcacggcggcaaggtcgcg
ctgctcggcattccgcccgcgcagacggcaatcgactggaatcaggtgatcttcaaggga
ctcgagatcaagggcatctacggtcgcgagatgttcgagacctggtacaagatggtcgcg
atgctgcaaagcggcctcgatctgtcgccgatcatcacgcatcgttttgcggccgacgat
tacgaaaaaggctttgctgcgatgctgtccggcgaaagcggcaaggtgatcctcgactgg
acggtttga

DBGET integrated database retrieval system