KEGG   Burkholderia territorii: WS51_03730Help
Entry
WS51_03730        CDS       T04843                                 

Definition
(GenBank) peptidase C45
Organism
btei  Burkholderia territorii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAT CBFB_NFYA
Motif
Other DBs
NCBI-ProteinID: AOI62749
LinkDB All DBs
Position
2:819351..820394
Genome map
AA seq 347 aa AA seqDB search
MPLSLSPVIAGTPFDIGVRLGELARPVFDAYMQQSRAWHAVRRWRGHPFVAALRQAALAA
YPELVAELDGIAAGIGWPADDIFLWNCRGELIHHAPDGCTTLAGRDAHGTRWIAHNEDGD
PYLRERCLLVDVQPHGKPGFISFYYPGSLPGHTFAANRAGIAQAINNLRIRTPAAGVPRM
ILARAVLDATSLDAAADVLRTHARASGFHHTLGATGDTRLLSIEASVARCSIVDVARLAG
HANHLVHPGCEPEAQIVTQSSADRQRRVDALTPGIDAIDEAALLRVLGDRAPEGLPIHRD
DPADPDDENTLATAIFAIRDTAIDFTIHQHGTQCFATRVVPSAPGAF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgccgctttccctttctcccgtcatcgccggcacgccgttcgacatcggcgtgcgcctc
ggcgagcttgcccgccccgtgttcgacgcatacatgcagcagagccgcgcatggcacgcc
gtgcgccgctggcgcggccatccgttcgtcgccgcgctgcggcaggccgcgctggctgcg
tatcccgagctcgtcgcggaactcgacgggatcgcggcgggcatcggctggccggccgac
gacattttcctgtggaactgccgtggcgaactgatccatcacgcgccggacggctgcacg
acgctcgccgggcgcgacgcgcatggcacgcgctggattgcgcacaacgaggacggcgat
ccgtacctgcgcgagcgctgcctgctggtcgacgtgcagccgcacggcaagccgggcttc
atcagcttctattacccgggatcgctgcccgggcatacgttcgccgcgaaccgcgcgggc
atcgcgcaggcgatcaacaacctgcgcatccgcacgccggcggccggcgtgccgcggatg
atcctcgcgcgcgccgtgctcgacgcgacgtcgctcgatgcggccgccgacgtgctgcgc
acgcatgcacgcgcgagcggcttccaccacacgctcggcgcgaccggcgatacgcggctc
ctgagcatcgaggcgagcgtcgcgcgctgctcgatcgtcgacgttgcgcgtcttgccggt
catgcgaatcatctcgtgcatccggggtgcgagccggaagcgcagatcgtcacgcaatcg
tccgccgaccgccagcggcgcgtcgatgcgctgacgccgggcatcgatgcgatcgacgag
gccgcgctgctgcgcgtgctcggcgaccgagcacccgaagggctgccgatccatcgcgac
gatccggccgaccccgacgacgaaaacacgctggcgaccgccatattcgcgattcgcgac
accgcgatcgacttcaccattcaccagcacggcacgcagtgcttcgcgacgcgcgtcgtg
ccgtccgcgcccggcgcgttctga

DBGET integrated database retrieval system