KEGG   Burkholderia territorii: WS51_03920
Entry
WS51_03920        CDS       T04843                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
btei  Burkholderia territorii
Pathway
btei00440  Phosphonate and phosphinate metabolism
btei00998  Biosynthesis of various secondary metabolites - part 2
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    WS51_03920
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    WS51_03920
Enzymes [BR:btei01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     WS51_03920
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AOI62782
UniProt: A0A124YUN3
LinkDB
Position
2:complement(866729..868414)
AA seq 561 aa
MNAREPNFSESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQSVAREIHENETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGAGNGGAQ
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtcggcacggatcgtc
cgcgaagcgggcttcaaggggatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagtgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggttggggaatggacgaggcgctgcgccgc
gcgaacgcatacgcggaagccggcgcggacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcacgcgaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatcggcgatgcagtccgtcgcgcgcgaa
atccacgaaaacgagacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcgatcgtgctcgccgcgagccgcggcaagggcctggaagcc
gtcaccgaggacaagcccaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgagcgccatgcgcaaacg
ggcgaactcgcgtcgctcgcatgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctcaccgagaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggccgccgacgaccgcggcctgttcggtcagaagacgtatctgcaacgtgta
tcgagcgacgtcgccgccggcacgccgcacggccgctggatcggcctgctgaacgtacgc
ggcgcgggcgtcgagcgcctgaaggcaatgctcgcgacgctgcaggcgcgacccgatttc
gacacgctcgacatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgatctggaagacttccgccgggcg
ggcgacttcgcacacggccagacgccgctgtccgagccgggcgccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system