KEGG   Burkholderia territorii: WS51_17510Help
Entry
WS51_17510        CDS       T04843                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
btei  Burkholderia territorii
Brite
KEGG Orthology (KO) [BR:btei00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    WS51_17510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR
Motif
Other DBs
NCBI-ProteinID: AOI65414
LinkDB All DBs
Position
1:1512880..1514211
Genome map
AA seq 443 aa AA seqDB search
MPKLSVDLDTLKRLAQFAARRSAEDRIPQVAGSLTFTTMLALVPLVTVAFALFTAFPMFA
SFQISLQGFLADHLMPAQFNVQIFKYLNQFASKAKGLTTAGLIVLVVTSVMTMMTIESAF
NLIWRVRKPRPFAQRVLAYWALITLGPLLFGVSLSISSYLFTQSLAFTGAAPSTSIVEWL
LAFASLPLTVLAFTLLYVYLPNCTVAWRDAVIGGLFAAIAFELAKRGFGYYVRRIPTYTA
VYGAFAALPVFLLWVYLSWFIALLGAMVASALPAIRVGQFHRIHYPGSDLLDALELLARL
AEARAAGKAGYTAMRLATMLRCDMETAQRLLLTMEEREWIARLESGEPAPRYILLANPEQ
LTLAQLFDVLVIDRTELTYQLQRRRSHVEGAALLEVLSNDRFDVSLASLIAAHRLAGEQP
EETVPGPAPGGARDPHARPPKTA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaagttgagcgtcgatctcgacaccctcaagcgcctcgcgcagttcgcggcccgg
cgcagcgccgaggatcgcatcccgcaagtggcgggcagcctcacgttcacgacgatgctg
gcactcgtgccgctcgtgacggtcgcgttcgcgctgttcaccgcgttcccgatgttcgcg
tcgttccagatctcgctgcaggggttcctcgcggatcacctgatgcccgcccagttcaac
gtccagatcttcaagtacctgaaccagttcgcgtcgaaggccaaggggctgacgacggcc
ggcctgatcgtgctcgtcgtcacgtcggtgatgacgatgatgacgatcgaatccgcattc
aacctgatctggcgggtgcgaaagccgcggccgttcgcgcagcgcgtgctcgcgtactgg
gcgctgatcacgctcggcccgttgctgttcggcgtgagcctgtcgatctcgtcgtatctg
tttacgcagtcgctggcgttcaccggcgccgcaccgtcgacgtcgatcgtcgaatggctg
ctcgcgttcgcgtcgctgccgctgacggtgctcgccttcacgctgctgtacgtgtacctg
ccgaactgcacggtcgcatggcgcgacgcggtgatcggcgggctgttcgcggccatcgcg
ttcgagctcgcgaagcggggcttcggctattacgtgcggcgcattccgacttatacggcc
gtctatggcgcgttcgcggcgctgccggtgttcctgttgtgggtgtacctgagctggttc
atcgcgctgctcggcgcgatggtggcgtccgcgctgccggcgatccgtgtcggccagttc
caccgcatccattatccgggcagcgacctgctcgacgcgctcgaattgctcgcgcggctg
gccgaggcgcgcgcggccggcaaggcaggctacacggcgatgcggctcgcgaccatgttg
cgctgcgacatggaaaccgcgcagcggctgctgctgacgatggaggagcgcgaatggatc
gcgcggctggaaagcggcgaacccgcgccgcgctacattctgctggcgaatcctgagcaa
ctgacgctggcgcagctgttcgacgtgctggtgatcgaccgcaccgagctgacctaccag
ctgcagcgacgccgcagccacgtcgaaggcgcggcgttgctcgaggtgctgtcgaacgac
cggttcgacgtatcgcttgcgtcgctgatcgccgcgcaccggctcgccggtgagcagcct
gaagagaccgtgccggggccggcgccgggcggcgcgcgcgacccgcacgcgcggccgccg
aaaacggcgtga

DBGET integrated database retrieval system