KEGG   Burkholderia territorii: WS51_17805Help
Entry
WS51_17805        CDS       T04843                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
btei  Burkholderia territorii
Pathway
btei00020  Citrate cycle (TCA cycle)
btei00310  Lysine degradation
btei00380  Tryptophan metabolism
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01120  Microbial metabolism in diverse environments
btei01130  Biosynthesis of antibiotics
btei01200  Carbon metabolism
Module
btei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btei00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WS51_17805 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WS51_17805 (sucA)
   00380 Tryptophan metabolism
    WS51_17805 (sucA)
Enzymes [BR:btei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WS51_17805 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOI65467
UniProt: A0A107HV43
LinkDB All DBs
Position
1:1576531..1579395
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLNNPASVPENWREYFDALQNVPATDGSNAND
VAHFPIVESFAERAKANAFIPRESTSNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEGDLDQTYSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESIRATPSFSVDKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKRGVQEIIIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADNYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTVPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAD
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcagtttcagctgaactcctatctgttcggcggcaatgcttcg
tacgttgaagaactgtacgatgcatacctcaacaatccggcatcggtgccggagaactgg
cgagagtatttcgacgcgctgcagaacgtgcctgcaaccgacggctcgaacgccaacgac
gtcgctcacttcccgatcgtcgaatcgtttgccgagcgcgcgaaggccaatgccttcatc
ccgcgcgaaagcacgagcaatctggcgaccgcgcgcaagcaggtccatgtccagtccctc
atcagcgcatatcgcttcctcggctcgcaatgggccaatctggatccgctgaagcgtcgc
gaacgtcccgccattcccgaacttgaacctgctttctacgacttctccgaaggcgacctc
gaccagacctacagcgcaagcaacctgtatttcggtttcgaccaggcatcgctgcgcgac
atcgtcaagggcttgcgtgacacgtattgcggcacgatcggcgccgaatacatgtacatc
agcgatccggagcaaaagcgctggtggcaggagcgcctggaatcgatccgcgcgacgccg
tccttctcggtcgacaagaagaagcacatcctgaaccgcctgacggcagcggaaggcctc
gagcgctatctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcaggcaagcgcggcgtgcaggaa
atcatcatcggcatggcgcaccgcggccgtctgaacgtgctggtcaacacgctcggcaag
atgccggccgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggt
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgaccgaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgaaggttcc
gcgaaggcacggatggaccgccgcggcgacgaagacggcctgcaagtgctgccggtgcag
atccacggtgacgcggcctttgccggccagggcgtcgtgatggaaacgctgaacctcgca
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtggtcaag
atgatcgaagcgccggtgctgcacgtaaacggcgacgatccggaagccgtcgtcctcgcg
acccagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggccacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgcggagaagctcgtgcag
cagggcgtgatcaccgcggaagacgccgacaactacgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacaccgtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactgggttccgttcctgaaccgcaagtggacggacgcggccgatacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacggtcccggaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgaacacctcgcattcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgaccggccaggactcgggccgcggcacgttcacgcaccgtcatgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgac
ggtcaggcgaagttcacggtgatcgactcggtgctgtcggaagaagcggtgctgggcttc
gaatacggttactcgaccgccgagccgaacacgctcgtgctgtgggaagcccagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggtctcacgatgctgctgccgcacggctacgaaggccagggtccg
gaacactcgtcgacgcgtatcgagcgtttcctgcagctgtgcgccgatcacaacatgcag
gtcgttcagccgacgacgccggcgcagatcttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcaacgccgaagtcgctgctgcgccacaaggaagcg
gtgtcggacctgtcggagctcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtgtgctcgggccgcgtgtattac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgag
cagttgtatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagaacgcg
actgaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaagggcagaagctggcatacagcggccgtccggct
tcggcctcgccggcggttggctactacgcgaagcactacgagcagcagaaggccctcatc
gaaggtgcattcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system