KEGG   Burkholderia territorii: WS51_18520Help
Entry
WS51_18520        CDS       T04843                                 

Definition
(GenBank) nodulation factor ABC transporter ATP-binding protein NodI
  KO
K09695  lipooligosaccharide transport system ATP-binding protein
Organism
btei  Burkholderia territorii
Pathway
btei02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:btei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    WS51_18520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:btei02000]
    WS51_18520
Transporters [BR:btei02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipooligosaccharide transporter
    WS51_18520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_22 SMC_N AAA_23 KdpD
Motif
Other DBs
NCBI-ProteinID: AOI65596
LinkDB All DBs
Position
1:complement(1706142..1707056)
Genome map
AA seq 304 aa AA seqDB search
MSVAPIDFRNVEKRYGDKLVVNDLSFHVQAGECYGLLGPNGAGKTTTLKMLLGLAYPDAG
AISLCGEPVPSRARHARQRVGVVPQFDNLDPDFTVRENLLVFSRYFGMSAHTARALVQPL
LEFAKLENKADAKVGELSGGMKRRLTLARALVNDPDVLVLDEPTTGLDPQARHLMWERLR
SLLARGKTILITTHFMEEAERLCDRLCVIEEGRKIAEGAPHALIESEIGCDVIEIYGPDP
VALRDELAPFAKHTEISGETLFCYVTDPEPLSARLKGRTGLRYLHRPANLEDVFLRLTGR
DMQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgcaccgatcgatttccggaacgtcgaaaagcgctatggcgacaagctcgtc
gtcaacgacctgtcctttcatgtacaggccggcgaatgctatggcctgctcgggccgaat
ggcgcgggcaagaccacgacgctgaagatgctgctcggcctcgcgtatcccgacgccggc
gccatttcactctgcggcgagccggttccgtcacgcgcgcggcatgcgcgccagcgcgtc
ggcgtcgtcccgcagttcgacaatctcgatcccgatttcaccgtgcgcgagaacctgctc
gtgttcagccgctatttcgggatgtcggcacacaccgcacgcgcgctcgtgcaaccgctg
ctcgaattcgcgaagctggaaaacaaggctgatgcgaaagtcggcgaactgtcgggcggc
atgaagcgccgtctgacgctcgcgcgcgcactcgtcaacgatcccgacgtgctggtgctc
gacgagccgacgacaggcctcgatccgcaggcgcggcacctgatgtgggagcggttgcga
tcgctgctcgcgcgcggcaagacgatcctcatcaccacgcacttcatggaagaagccgag
cgcctgtgcgaccggctgtgcgtgatcgaggaaggccggaagatcgccgaaggcgcgccg
cacgcgctgatcgaatcggaaatcggttgcgacgtgatcgagatctacgggccggacccg
gtcgcgctgcgcgacgagctcgcgccgttcgcgaagcacaccgagatcagcggcgagacg
ctgttttgctacgtgaccgatcccgagccgctcagtgcgcggctcaagggtcgcacggga
ttgcgctatctgcatcgcccggccaatctggaagacgtgttcctgcggctcacgggccgc
gacatgcaggactga

DBGET integrated database retrieval system