KEGG   Burkholderia territorii: WS51_21020Help
Entry
WS51_21020        CDS       T04843                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btei  Burkholderia territorii
Pathway
btei00010  Glycolysis / Gluconeogenesis
btei00020  Citrate cycle (TCA cycle)
btei00620  Pyruvate metabolism
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01120  Microbial metabolism in diverse environments
btei01130  Biosynthesis of antibiotics
btei01200  Carbon metabolism
Module
btei_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS51_21020
   00020 Citrate cycle (TCA cycle)
    WS51_21020
   00620 Pyruvate metabolism
    WS51_21020
Enzymes [BR:btei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     WS51_21020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23 DUF4813 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AOI66048
LinkDB All DBs
Position
1:complement(2267457..2269103)
Genome map
AA seq 548 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKAGDTVEPEQSLVTLESDKATMDVPSPAAGTVKEV
KVKVGDSVSEGSLIVLLEGGAAAQANGAAAPAAAPAPAAAPAAAAPAAAPAAAGGTLEVK
VPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGVVKEIKVKVGDSV
SEGTLIVLLDAAGAAPAAAPQASAPAPAPAAAAPAPAAAPAPAKAAPAPAAAAPAAAPSG
EYRASHASPSVRKFARELGVDVARVQGSGPKGRITKEDVTSFVKGAMTGQRAAPAAAAAP
AAGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELE
ALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADT
PNGLVVPVIRDADKKGLVDIAKEMAELSKAARDGKLKPDQMQGGCFSISSLGGIGGTHFT
PIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALL
ADFRRIIL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtgaaggcgggcgacacggtcgagcccgagcagtcgctcgtcacgctc
gagtcggacaaggcaacgatggacgtgccgagcccggccgccggcacggtcaaggaagtg
aaggtcaaggtgggcgattccgtgtcggaaggctcgctgatcgtcctgctcgaaggcggc
gccgcggcgcaggcgaacggcgcggccgcgccggcggcagcaccggctccggcagcggca
ccggccgcggcagcgccggctgccgctcccgctgctgcgggcggcacgctcgaggtgaag
gtgcccgacatcggcgactacaaggacgtcccggtgatcgagatcggcgtgaaggtcggc
gacacggtcgagaaggagcagtcgctcgtcacgctcgagtcggacaaggcgacgatggac
gtgccgagcccggccgccggcgtcgtgaaggaaatcaaggtcaaggtgggcgattcggtg
tcggaaggtacgctgatcgtgctgctcgacgccgccggcgcagcgcctgccgccgcgccg
caggcgagcgcaccggcacctgcaccggccgctgccgcgccggctccggccgccgcaccg
gcgcccgcgaaggctgcgccggctccggctgccgctgcgccggccgccgcgccgtcgggc
gagtaccgcgcgagccacgcatcgccgtccgtgcgcaagttcgcacgcgaactcggcgtc
gacgtcgcacgcgtgcagggcagcggtccgaagggccgcatcacgaaggaagacgtcacg
agcttcgtgaagggcgcgatgacgggccagcgcgcggcaccggccgcggcagccgcgccg
gctgccggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggc
ccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgc
aactgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgagctcgaa
gcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaaattcacgatgctc
gcattcgtgatcaaggcggtcgtcgcggcgctgaagaagttcccgaccttcaatgcgagc
ctcgacggcgacaacctggtgttcaagcagtactaccacatcggtttcgccgcggacacg
ccgaacggtctcgtcgtgccggtgattcgcgacgcggacaagaagggcctcgtcgacatc
gcgaaggaaatggccgagctgtcgaaggccgcgcgcgacggcaagctcaagcccgaccag
atgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacccacttcacg
ccgatcatcaacgcgccggaagtcgcgatcctcgggttgtcgcgcggccagatgaagccg
gtgtgggacggcaagcagttcgtgccgcgtctgacgctgccgctgtcgctgtcgtatgac
catcgtgtcatcgatggcgcggaagccgcgcggttcaacgcgtatctcggcgcgttgctg
gccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system