KEGG   Burkholderia territorii: WS51_22375Help
Entry
WS51_22375        CDS       T04843                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
btei  Burkholderia territorii
Pathway
btei00620  Pyruvate metabolism
btei00680  Methane metabolism
btei00710  Carbon fixation in photosynthetic organisms
btei01100  Metabolic pathways
btei01120  Microbial metabolism in diverse environments
btei01200  Carbon metabolism
Module
btei_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS51_22375
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    WS51_22375
   00680 Methane metabolism
    WS51_22375
Enzymes [BR:btei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     WS51_22375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOI66289
LinkDB All DBs
Position
1:2562635..2565649
Genome map
AA seq 1004 aa AA seqDB search
MKSSGSARTMRRNAALPSSDAQTGSIATAANGRAKTATKPKDSIRQTKRAINDAGPAART
AGAAKPGARTREDKDGPLFEDIRYLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDD
SEAAQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTV
AYALEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQP
LTARERAYNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIE
AALAEHGLSARVPAFFQMGSWIGGDRDGNPNVTAATLEEAINRQSAVILEHYLEQVHKLG
AELSVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVP
VRSAGRGAPPVRAVPYADSEAFVADLKVLTASLDEHHGTSLAAPRLAPLVRAAEVFGFHL
ASIDLRQSSDIHEAVVAELFARAGVHADYASLSEDDKLIALLAALADPRPLRSPYIEYSA
LAQSELGVFEKAREVRAQFGPRAVRNYIISHTETVSDLVEVLLLQKETGLLEGTFGAAHD
SARNGLMVIPLFETIPDLRDAARIMREYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGF
LTSNWELYRAELALVELFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRL
TEQGEVIASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDAAMAS
YRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQ
CRLLLTGWYGFGSAVSAYLDGAKDAAERTRRVALLKKMNKTWPFFANLLSNMDMVLAKTD
LAVASRYAQLVADRKLRKHVFERIVAEWERTSQALAEITGHTGRLATNPLLARSIKNRFP
YLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcacgatgcgccgcaatgctgccttgccctcctccgac
gcccagacgggctccatcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagactcgatacgtcagacgaaacgcgcgatcaacgacgccggcccggccgcccgcacg
gccggtgcggcgaagcccggcgcccgcacgcgcgaggacaaggacggcccgctgttcgag
gacatccgctacctcggccgcctgctcggcgacgtggtgcgcgagcaggaaggcgacacc
gtgttcgacgtcgtcgagaccattcgccagacggcggtgaagtttcgccgcgaggacgac
agcgaggccgcgcaaacgctggagaagaagctgcgcaagctgacgccggagcagacggtg
agcgtcgtgcgcgcgttcagctatttttcgcatctggcgaacatcgcggaagaccgccat
cacaaccgccgccgccgcatccacgcgctggcgggctccgcgccgcagccgggcaccgtc
gcctacgcgctcgagcagctgaagacgaccggcaacgcgtcgaagcgcctgctgcagcgc
ttcttcgacgatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgc
aagagcatcctcgacgcgcagcacgacatcgctcgcctgctcgccgagcgcgaccagccg
ctgacggcgcgcgaacgcgcgtacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctg
tggcagacccgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcg
ctgtcttactaccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgag
gccgcgctggccgagcacggcctgtccgcgcgcgtgcccgcgttcttccagatgggcagc
tggatcggcggcgaccgcgacggcaacccgaacgtcaccgccgcgacgctcgaggaagcg
atcaaccgccagtccgcggtgatcctcgaacactacctggaacaggtgcacaagctcggc
gccgagctgtcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaagcgctggcg
gccgcgtcgcccgaccagtcgccgcatcgcgtcgacgaaccgtatcgccgtgcgttgatc
ggcatctacacacggctcgccgcgagcgcgcgcgtgcgtctcggcgaaggcacggtgccg
gtgcgcagcgccggccgcggcgcgccgccggtgcgcgcggtgccgtacgccgattccgaa
gccttcgtcgccgacctgaaggtgctgaccgcgtcgctcgacgagcatcacggcacgtcg
ctcgccgcgccgcgcctcgcaccgctcgtgcgcgcggccgaggtattcggcttccatctg
gcgagcatcgacctgcgccagagctccgacatccacgaagccgtggtcgcggaactgttc
gcgcgcgccggcgtacatgcggactacgcgtcgctgtccgaggacgacaagctgatcgcg
ctgcttgccgcgctggccgatccgcgcccgctgcgctcgccgtacatcgaatactcggcg
ctcgcgcaaagcgagctgggcgtgttcgagaaggcacgcgaggtgcgcgcgcagttcggc
ccgcgcgcggtacgcaactacatcatttcgcacaccgagacggtcagcgacctcgtcgaa
gtcctgctgctgcagaaggaaaccgggctgctcgaaggcacattcggcgccgcgcacgac
agcgcacgcaacggcctgatggtgattccgctgttcgagacgatccccgacctgcgcgat
gccgcgcgcatcatgcgcgaatacttcgcactgccgggcatcgacgcgctgatcgcgcac
cagggtgccgagcaggaagtgatgctcggctactcggacagcaacaaggacggcggcttc
ctgacgtcgaactgggagctgtatcgcgcggagctcgcgctcgtcgagctgttccgcgag
cgcaagatcacgctgcggctgttccacggccgcggcggcacggtcggccgcgggggcggc
ccgacctaccaggcgatcctgtcgcaaccgccgggcaccgtgaacggccagatccggttg
accgaacagggcgaggtgatcgcgagcaagttcgcgaaccccgagatcggccggcgcaat
ctcgagacggtcgtcgccgcgacgctcgaggcgtcgctgctgccgcaatcgaacgcgccc
gcgcagctgcccgcgttcgaagccgcgatgcagacgctgtccgacgccgcgatggcgtcg
tatcgcgcgctcgtctatgaaacgcccggcttcaccgactacttcttctcgtcgacgccg
atcaccgaaatcgccgagctgaacatcggcagccgcccggcctcgcgcaagctgcaggat
ccgaagaaccgcaggatcgaagacctgcgcgcgatcccgtggggtttctcgtggggccag
tgccggctgctgctgacgggctggtacggcttcggcagcgcggtgagcgcatatctcgac
ggcgcgaaggacgcggccgagcgcaccaggcgcgtcgcgctgctcaagaagatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcaaagaccgac
ctcgcggttgcgtcgcgttacgcacagctggtcgccgatcgcaagctgcgcaagcacgtg
ttcgagcggatcgtcgcggaatgggagcgcacgtcgcaggcgcttgcggagattaccggc
cataccggccgcctcgcgaccaatccgctgctcgcgcgctcgatcaagaaccgcttcccg
tatctcgatccgctgaaccacctgcaggtcgagctgatcaagcgtcaccgcgcgggcgac
acgaacgcgcggctgcgccgcgggatccacctgaccatcaacgggatcgcggccggcctg
cgcaatacgggctga

DBGET integrated database retrieval system