KEGG   Burkholderia territorii: WS51_23970Help
Entry
WS51_23970        CDS       T04843                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
btei  Burkholderia territorii
Pathway
btei00071  Fatty acid degradation
btei00280  Valine, leucine and isoleucine degradation
btei00281  Geraniol degradation
btei00362  Benzoate degradation
btei00592  alpha-Linolenic acid metabolism
btei01100  Metabolic pathways
btei01110  Biosynthesis of secondary metabolites
btei01120  Microbial metabolism in diverse environments
btei01130  Biosynthesis of antibiotics
btei01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WS51_23970
   00592 alpha-Linolenic acid metabolism
    WS51_23970
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WS51_23970
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    WS51_23970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WS51_23970
   00642 Ethylbenzene degradation
    WS51_23970
Enzymes [BR:btei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     WS51_23970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOI66579
LinkDB All DBs
Position
1:complement(2923990..2925189)
Genome map
AA seq 399 aa AA seqDB search
MSKQLQDAYIVAASRTPIGKAPRGVFKNTRPDELLVHAIKSAVAQVPGLDTKVIEDAIIG
CAIPEAEQGLNVARMGALLAGLPQTVGGVTVNRFCASGITALAMAADRIRVGESDALLAG
GCESMSMVPMMGNKPSMSPHIFDRSEDFGIAYGMGLTAERVAEQWKVSREDQDAFSVESH
RKALAAQQAGEFGDEIAAYTITERFPNLSTGEVDVKTREIKLDEGPRADTSLEGLAKLRT
VFANKGSVTAGNSSQTSDGAGALLVVSEKVLKEFNLTPLARFVSFAVRGVPPEIMGIGPK
EAIPAALKAAGLKQDDLDWIELNEAFAAQSLAVIRDLGLDPSKVNPVGGAIALGHPLGAT
GAIRAATVVHGLRRRNLKYGMVTMCVGTGMGAAGIIERL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaattgcaagacgcatacatcgtcgccgccagccgcacgccgatcggcaag
gctccgcgcggtgtcttcaagaacacgcgcccggacgaactgctggttcacgcgatcaag
tcggcggtcgcgcaggtgcccggcctcgacacgaaggtgatcgaggacgcgatcatcggc
tgcgcgattcccgaagccgagcagggcctgaacgtcgcgcgcatgggcgcgctgctcgcg
ggcctgccgcagacggtcggcggcgtgacggtcaaccgcttctgcgcgtcgggcatcacg
gcgctggcgatggcggcggaccgcatccgtgtcggcgaatcggacgcgctgctcgcgggc
ggctgcgaatcgatgagcatggtgccgatgatgggcaacaagccgtcgatgtcgccgcac
atcttcgatcgcagcgaggatttcggcattgcctacgggatgggcctgacggccgagcgc
gtcgccgagcagtggaaggtgagccgcgaagaccaggatgcattctcggtcgagtcgcac
cgcaaggcgctcgccgcgcagcaggccggcgagttcggcgacgaaatcgccgcgtacacg
atcaccgagcgtttcccgaacctctcgaccggcgaagtcgacgtgaagacgcgcgagatc
aagctggacgaaggtccgcgcgcggatacgtcgctcgaaggcctcgcgaagctgcgcacg
gtgttcgcgaacaagggctcggtgacggccggcaacagctcgcagacgtcggacggcgcg
ggcgcgctgctggtcgtgtcggagaaggtgctcaaggaattcaacctgacgccgctcgcg
cgcttcgtgagtttcgcggtgcgcggcgtgccgccggaaatcatgggcatcggcccgaag
gaagcgatcccggccgcgctgaaggccgccggcctgaagcaggacgatctcgactggatc
gagctgaacgaggcattcgccgcgcagtcgctggcggtgatccgcgatctcggcctcgac
ccgtcgaaggtcaacccggtcggcggcgcgatcgcgcttggccacccgctcggcgcgacc
ggcgcgatccgcgcggcgaccgtcgtgcacggcctgcgccggcgcaacctgaagtacggg
atggtcacgatgtgcgtcggcaccggcatgggtgcggcgggcatcatcgaacgcctgtaa

DBGET integrated database retrieval system