KEGG   Bombus terrestris (buff-tailed bumblebee): 100631087Help
Entry
100631087         CDS       T04364                                 

Definition
(RefSeq) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00330  Arginine and proline metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100631087
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bter04147]
    100631087
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     100631087
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100631087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 100631087
NCBI-ProteinID: XP_003401502
LinkDB All DBs
AA seq 374 aa AA seqDB search
MGGCTSKDTTSNDDKKNSNMVDQAVLDKLEAGFSKVAGSDSKSLLKKYLSKEVFDQLKTK
KTSFGSTLLDVIQSGVENLDSGVGIYAPDADSYTVFADLFDPIIEDYHGGFKKTDKHPPK
DFGDVDSLGNLDPAGEFIVSTRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGE
LKGTFYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDAKTFLVWC
NEEDHLRIISMQMGGDLGQVYRRLVSAVNEIEKRLPFSHHDRLGFLTFCPTNLGTTVRAS
VHIKLPKLAANREKLEEIAGKFNLQVRGTRGEHTEAEGGIYDISNKRRLGLTEYQAVKEM
HDGIAELIKLEKEL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatgtacctctaaggataccacgtcgaacgacgacaagaaaaatagcaatatg
gttgaccaggcagttttggacaaactggaagctggcttctccaaagtggctggctctgat
agcaaatctctgctgaagaagtatctgtccaaagaggtcttcgatcaactgaagacaaag
aagacttcctttggatccactctccttgatgtgatccagtctggtgtagagaatctggac
tctggtgtcggtatctacgcgcctgatgctgattcttacacagtttttgctgacctcttc
gatcccatcattgaagactaccatggtggcttcaagaaaactgacaagcatccaccaaaa
gactttggagatgtcgatagtcttggcaaccttgacccagctggtgagttcatcgtctcc
acccgtgtaagatgcggccgttccctggaaggctatccattcaacccctgcctgactgaa
gctcagtacaaagaaatggaagagaaagtctctagcactttgtctggcttagagggtgaa
ctcaagggaactttctatcctctaactggtatgagcaaagaagttcagcagaaactgatc
gacgaccacttcctgttcaaggagggtgatcgcttcttgcaagctgccaatgcttgccgc
ttctggcccactggccgtggtatctaccacaacgatgccaagaccttcttggtctggtgc
aacgaggaagatcatctccgtatcatttccatgcagatgggcggtgatcttggacaggtc
taccgtcgtctggtgagcgccgtgaacgagatcgaaaaacgacttcctttctcccaccac
gaccgtcttggtttcttgaccttctgccctaccaacttaggtactactgtccgtgcctct
gtacacatcaaactgcctaaattggccgctaacagggagaagcttgaagaaattgctgga
aagttcaatctccaggtccgtggtactcgcggagagcacaccgaggccgagggtggtatc
tacgacatttccaacaaacgacgtctcggtctgaccgagtatcaggctgtgaaggagatg
cacgatggaatcgccgagctgatcaagctcgagaaagaactttaa

DBGET integrated database retrieval system