KEGG   Bombus terrestris (buff-tailed bumblebee): 100642264Help
Entry
100642264         CDS       T04364                                 

Definition
(RefSeq) NADP-dependent malic enzyme isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00620  Pyruvate metabolism
bter01100  Metabolic pathways
bter01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100642264
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     100642264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic DUF4932
Motif
Other DBs
NCBI-GeneID: 100642264
NCBI-ProteinID: XP_003401068
LinkDB All DBs
AA seq 627 aa AA seqDB search
MFVLQRSILSPSSRNCAGSWARMLPPTHPAAKDIQRIYREIHEVSGDVVPINMVKGIGHL
RDPRLNKGLAFTLQERISLGIHGLQPPRFKTQEEQLALCKASVMKYTEDLNRYLYLVELQ
ERNERLFFRLLSENIEQMMPIVYTPTVGLACQKFGVIYRRPRGLFITIYDKGHIYEILNN
WPEQAVRAICVTDGERILGLGDLGACGMGIPVGKLALYTALAGIKPHQCLPITIDVGTNN
EQLRDDPHYIGLNKPRSQGAEYDELIDEFMAACVKKYGQNVLIQFEDFGNHNAFRFLDKY
RDKYCTFNDDIQGTAAVAVAGILASKRITKKSMSQNKFVFLGAGEAAIGIADLCVKAMEA
DGCTEQEARNNIWMMDIDGLLVKNRPEGNLEGHKIWYAKDHKVMKSLLEVVKEVKPTVLI
GASAAAGAFTPEVLREMAKINERPLIFALSNPTIKAECTAQQAYDYTNGKCIFSSGSPFG
EVHYNGKVYKPGQGNNAYIFPGIALGVIATGCHHITEDLFLISAQAVADHVKDEDLEVGS
LYPPLSTIRECSIDIAVRIADYAYAKTGLASEYPEPKDKREFIVSKMYDANYDSPLPNLY
DWPGDYAKPRVLPDKDTVEIRHDLKHL
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtcctgcagaggtctatattatcgcccagcagcagaaattgtgcaggatcatgg
gcgcgaatgctgccacctacgcatcctgctgcaaaagatattcaaaggatatacagagaa
atccacgaagtgtctggagatgtcgtacctatcaatatggtgaaaggtattggccatttg
agggaccctcgacttaataagggactggcatttactttgcaagaaagaatatccttaggt
atacacggcttgcaaccaccaagattcaaaactcaggaagaacaattggctctgtgcaag
gcctcagtcatgaagtatactgaggatttaaatcggtatctttatctcgtggaattacag
gaaagaaacgagagattgttttttcgtctattaagtgaaaacatcgagcagatgatgcca
atcgtatatactcctaccgtcggattagcctgtcagaagtttggcgttatctatcgcaga
cctcgtggattatttatcacaatatatgataaaggtcacatttacgagatcttaaacaac
tggcctgagcaagcggttcgtgcaatttgcgtaacagatggagagagaattctcggtctc
ggtgatctcggtgcttgtgggatgggaattccggtaggaaaattagctctttacaccgcc
ctggctggcataaaaccacaccaatgcctaccaattactatcgacgtcggcacaaataac
gaacagctaagagacgatcctcattatattggtcttaacaaacccagaagtcaaggcgct
gaatatgatgaattgattgatgaatttatggctgcttgcgtgaaaaaatatggccaaaat
gttctcattcaattcgaggatttcggaaatcacaatgcctttcgtttcttagataaatat
cgcgacaagtattgtacgtttaacgatgatatacaaggtactgccgcagttgcggttgct
ggaattttagcatcgaaaagaataaccaagaaatctatgtcccaaaataaattcgtattt
ttgggtgctggtgaggcagccattggaatagctgacctttgtgttaaagcaatggaagca
gatggttgtactgaacaggaagcacgtaataatatttggatgatggatattgatggattg
ctcgttaaaaatcgaccagaaggtaacctggaaggtcataagatctggtatgcgaaagat
cacaaagtgatgaaatcactattggaagttgtaaaagaagtgaaaccaactgttctaatt
ggtgcttcagcagcagcaggagcattcactcctgaagtcttgagagaaatggccaaaatc
aatgaaagacctttgatctttgcattgagtaatccaactatcaaagcagagtgcacagct
caacaagcttacgattatacaaatggaaaatgcattttctcgtcgggttctccgtttggc
gaagtgcactataacggaaaagtatataaacctggacaaggaaacaacgcgtacattttt
cctggaatcgcattgggcgtcatcgcgactggatgtcatcacattacagaagatttattc
ctaatctcggctcaagctgttgctgatcacgtgaaagacgaagatctcgaagtgggcagt
ctctacccaccgttaagcactattcgtgaatgttcaattgatatcgccgtacgaattgct
gactacgcttacgctaaaactgggttggcaagtgagtatccagaaccaaaagacaaacgc
gaatttattgtaagtaagatgtacgatgctaactatgacagtccactgccaaatctttac
gactggccaggagattatgccaaaccacgtgttttaccagataaagacactgtagaaatc
cgccacgatttaaaacatctgtag

DBGET integrated database retrieval system