KEGG   Bombus terrestris (buff-tailed bumblebee): 100642427
Entry
100642427         CDS       T04364                                 

Definition
(RefSeq) uncharacterized protein LOC100642427
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
SSDB
Motif
Pfam: zf-CCHC Exo_endo_phos_2
Other DBs
NCBI-GeneID: 100642427
NCBI-ProteinID: XP_012173833
LinkDB
Position
Unknown
AA seq 790 aa
MPWETPMDLMFSYSRVAAGRCLWHPSVCRSGAENFGEVDGPMPVKTTHLIFSWGSPSPYS
GFDRGEGDPSTDAVVGSQVGPTASSFHDHGRSGVDGQAPGCVYASGEDATQIMEVVKEVR
ELPRKPTRSARKTSERSESLFLASAMVADATSPMAGLLRTRMRSNDEESVASLPSRSSVA
STASKGRKRKIMSTTVPEVCEELARQIRTSSAANVGAELTRHVSQLMLVATKSFNLKGTD
IKALKDAASYVTSAWQNETLKKPGPTHSDIGTAQSVEARLSVLEKSNAALRKELAKMTAC
AHECPRCSGLTSEPERTARKGADITALKRKEGRATPPPGVPPRRHRSQKSKRMGNERWWS
PKAPGERKKRRATAGEAAKKGATVTPPARGQESLRRMTGAPKTSIVAPKKGPAQTPKTAI
LLRTPRTSAVTVTLNEGSRMSYADVINTARQNIPLAEIGVESLNMRKAMTGAIVITVPGD
RDREKASRLATRLAKVLDSATARVAAPTRTAELRAAGCGSAEVQVGEIGHLQKWPRVSLD
QVPRSWCTETSPDRQSHPGLVHRDGHSHPEEALAMLQLPGTGTRTGYGVSAVDRGHQCYR
CGESGHRARGYPASAPKCPLCESLGAPVNHRMGGVACAPPPKTKRKRPVHEPAATAKTQG
NTAEAAVDGREEGHGIDPMNSRGSSRSEVAIAVVAAPYRIPDVTNWVGDLDGLAAITWTT
ALSAPSVVLDRGSGYVAVEWDGMALVGIYVSPNRGLAAFEDFLDGVGECVRRCLPRQELV
LGDFNAHSSQ
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgccctgggaaaccccgatggatctgatgttctcctatagtcgggtggcggctggtcgg
tgcctttggcacccgtcagtttgcagatccggggcggagaacttcggagaagttgatggg
cccatgcctgtcaagactactcacctcatcttctcgtggggctccccgtcaccctactcc
ggcttcgaccgaggggagggagaccccagtaccgacgcagttgtgggtagtcaagtgggc
cccactgcgtcgtcatttcacgaccacggccgttcgggggtagacggccaggcccccgga
tgtgtttatgcatctggcgaggacgcaacacaaatcatggaggtggtgaaggaggttaga
gagcttccaaggaaacctacgagaagtgcccgcaaaacttcggagaggtcggagagtttg
tttctcgcctcggccatggtagctgatgccacgtcaccaatggcaggattgctgcggaca
cgaatgaggtccaacgacgaagagtcggtcgcctcgctcccgtcgcgctcgtcagtggct
tcgacggcttccaagggaaggaagaggaaaattatgtcaaccacagtcccggaagtttgc
gaagaactggcgaggcaaataaggacgagctcagcggcgaacgtcggagccgaactaacg
aggcacgtctcgcaactgatgttggttgcgacgaaatcgttcaacctcaaagggacggac
attaaggcgttaaaggacgcggcgagttacgtaacctccgcgtggcagaatgaaacgctg
aaaaaaccggggccaacacacagcgacatcggaactgcgcagtcggtggaggccaggctg
tccgtgctggagaaatcaaacgcggcccttcgcaaagagctagcgaaaatgaccgcttgc
gctcacgagtgcccgcgatgcagtggcctgacttccgagccagaacgcaccgcacggaaa
ggggccgacatcacagccctgaagcgcaaagagggaagagccactccgccacccggtgta
ccacccagacgacatcgctcccaaaagagcaaaagaatggggaatgaaaggtggtggagt
ccaaaagctcccggagaaaggaaaaagaggagggcaaccgccggagaagcggcgaagaaa
ggggccactgtgactccaccggccagaggccaggaatccctaaggaggatgacaggcgcg
cctaaaacgagcatcgtcgcaccgaagaaaggaccagcgcagacgccgaagacggccatc
ctccttcgtacaccgcgaacatctgcggtgactgtaactctgaacgaggggtcaaggatg
tcctacgccgatgtaataaacacggctaggcagaacatcccccttgctgagatcggcgtc
gagtcgctgaacatgaggaaagcgatgacaggtgctatcgtgataacggtacccggagat
cgagacagggagaaggcgtcacggcttgcgacgcgcttggccaaggtgctagactcggcc
acggcgagagtggcggctccaacgaggacggcggagctgagagccgcaggatgcggcagc
gcggaggtgcaggtcggggagatcggacacctccagaaatggcctcgggtcagcctggat
caggtgccccgtagctggtgcacggaaactagcccagacaggcaaagtcatcctgggctg
gtccaccgcgacggtcatagccatcccgaggaggcccttgcaatgcttcaattgcctgga
actgggacacgtacgggctacggcgtgtccgccgtggaccgaggacaccagtgttacagg
tgcggcgaaagcggacatcgtgccagaggctatcctgcctcggcacccaagtgccccctg
tgcgagtcactcggggctcccgtcaaccacaggatgggtggggtggcatgtgcccccccc
ccgaaaaccaagaggaaacgacccgtccacgagccagcggcgacggcaaaaacgcaaggc
aacaccgccgaagcagctgtagatggccgggaggaaggccatggaattgacccgatgaat
tcaagaggctcctccagaagcgaggtcgccatcgcggtggtggctgcgccgtatcgcatc
cctgacgtgaccaactgggtcggggatctggatggattggcagccataacctggacaaca
gcgctgagcgcccccagcgttgtgctcgaccgtggcagcggttacgtcgcggtcgagtgg
gatgggatggcgctggtgggcatttatgtttctcccaaccgcggcctggccgcgttcgag
gacttcctggacggggttggcgaatgcgtcagaagatgccttccccgccaggagcttgtc
ctcggggatttcaacgcccactcctcgcagtga

DBGET integrated database retrieval system