KEGG   Bombus terrestris (buff-tailed bumblebee): 100642763Help
Entry
100642763         CDS       T04364                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04213  Longevity regulating pathway - multiple species
bter04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bter00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100642763
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100642763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bter03036]
    100642763
Enzymes [BR:bter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100642763
Chromosome and associated proteins [BR:bter03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100642763
   HDAC complexes
    Sin3A-HDAC complex
     100642763
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100642763
  Chromatin remodeling factors
   NuRD complex
    100642763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100642763
NCBI-ProteinID: XP_012166836
LinkDB All DBs
AA seq 492 aa AA seqDB search
MTTLPHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAT
ADEMTKFHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAA
AVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDESYESI
FVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNLTVRGHGKCVEFVKKYNLPFLMVGG
GGYTIRNVSRCWTYETSVALGSEIANELPYNDYFEYFGPDFKLHISPSNMANQNTPEYLE
KIKTRLFENLRMLPHAPGVQVQPIPEDGAVIEDSEAEEKVNPDERLPQRDLDKRIQHENE
YSDSEDEGEGGRRDNRSFKGSRKRPRLEKGQEGIESDLKKEEDIKSEPKENEKDEKTNVT
NEETKKDGGSNP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgttaccacatagcaagaagcgtgtctgctactattatgatagtgatattgga
aattattattatgggcaaggacatcctatgaagccacatcgtataaggatgacacataat
ttacttttgaattatggtctttataggaagatggaaatatatcgtccacataaagctaca
gcagatgaaatgacaaaattccatagcgatgactatattaggtttttgagatccataaga
cctgataatatgtcagagtataacaaacaaatgcaacgatttaatgtaggagaagattgc
cctgtctttgatggtttatatgaattttgtcaattatcagctggaggttctgttgctgcc
gctgtgaaacttaacaaacaggcctcagaaatttgcataaattggggtggtggcttgcat
catgccaaaaaaagtgaagcatctggattttgttacgtaaatgacattgtattaggaata
ctagaattactgaaatatcatcagagagtgttatatattgatattgatgttcatcatgga
gatggtgtagaagaagctttttataccacagatagagttatgacagtttcttttcataaa
tatggtgaatattttcctggtactggtgatctgcgtgatattggtgctggaaagggaaag
tattatgcagtcaatataccactaagagatggtatggatgacgaaagctatgaatcaata
tttgtacctattatttctaaagtgatggaaactttccaaccttctgctgtggtcctacaa
tgtggtgctgattcattaactggagatcggttaggctgtttcaatttaacagtgaggggt
catgggaaatgtgttgaatttgtaaaaaaatataatttacccttcttaatggtcggtggt
ggtggatatacaatcagaaatgtgtctagatgctggacatacgaaacttcggttgctctt
ggttctgaaattgcaaatgagttaccctataatgattattttgaatattttggtcccgat
tttaagctgcatattagtccttcaaatatggcaaatcaaaatactcctgaatatcttgag
aaaattaaaaccagactatttgaaaatttaagaatgttgccgcatgccccaggtgtgcag
gttcaaccaattccagaagatggtgcagtcattgaagattcagaggctgaggaaaaggta
aatccagacgaaagattaccacaacgagatttagataaaagaatacaacacgaaaatgaa
tatagcgacagtgaggatgaaggtgaagggggacgaagagataataggtcatttaagggt
tccagaaaacggccacgtctagaaaaaggacaagaaggtatagaaagtgatctaaaaaaa
gaagaggacataaaatcggaaccaaaagaaaatgaaaaagatgaaaaaacgaatgttaca
aatgaggaaacgaagaaagacggtggatcgaatccctga

DBGET integrated database retrieval system