KEGG   Bombus terrestris (buff-tailed bumblebee): 100643227Help
Entry
100643227         CDS       T04364                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00562  Inositol phosphate metabolism
bter01100  Metabolic pathways
bter04068  FoxO signaling pathway
bter04070  Phosphatidylinositol signaling system
bter04140  Autophagy - animal
bter04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100643227
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100643227
   04070 Phosphatidylinositol signaling system
    100643227
   04150 mTOR signaling pathway
    100643227
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100643227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bter01009]
    100643227
Enzymes [BR:bter01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100643227
    3.1.3.48  protein-tyrosine-phosphatase
     100643227
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100643227
Protein phosphatases and associated proteins [BR:bter01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100643227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 Y_phosphatase PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 100643227
NCBI-ProteinID: XP_012174654
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MILCVSGECPYRVCVSIHVGKLRMQHRHCVVPHGRIHEYQWSWAILSFCYQEEVETEIIG
TEGGDLKFSQPSMSNTISNMKMTNRIKGMVSKRRRRFTEDGFDLDLTYIRDNLIAMGFPA
EKLEGVYRNHIDDVVKLLESRHKDHYKIYNLCSERSYDFKKFKQRVATYAFDDHNPPMLD
QIRPFCEDVHEWLSRHQENVAVVHCKAGKGRTGVMVCCYLLHTKQFPTATEALNYYGNKR
THDRKGVTIPSQRRYVDYYATLVQEGLDYQPVTLLLRKIQLDPAPIFHGGQGYLHCVISE
SKKKIFSSDIVEVRKGMHTVSIPLKHSIALTGDIRVDFFNRPKMKRKEKLFHFWFNTFFV
RDYLSPEYDNGELPVERSTRALSCDGATMELPVVMSHMKPRAGSLASLGPMPPTLVLSID
KWGLDDAHKDKHHKVYSADFKVSLFMHRMGGNISQTVSATTNRTGEGIQIGMGGQDTPSE
SSEADSSECDTTGDTTGDEDGESGESSASLVVNHHPLTHSSSRTHVSIHQRASLRETAKG
LLSHGDKSRSSHRQNTGNVKRSSALIRSATLDT
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgatcttatgcgttagtggtgagtgtccgtatcgcgtgtgcgtgtctatccatgttggc
aaattgaggatgcaacatagacattgtgttgttcctcacggtcgtattcatgaatatcaa
tggtcatgggcaatcttgtcattttgttatcaagaagaagtggagactgaaattattgga
actgagggaggagatttaaaattcagtcagccaagtatgtccaacactatcagtaatatg
aagatgaccaaccgtatcaagggaatggtgagcaaacgtcgtaggcgtttcacagaagat
gggtttgaccttgatctcacatatataagagataacttaatagcaatgggatttccagct
gaaaagttagaaggagtgtataggaatcacatagatgatgttgttaaactgttggaatct
aggcataaagatcattataagatttacaatctatgttcagagagatcttatgattttaag
aaatttaaacaaagggtagctacatatgcgtttgatgatcataatccaccaatgttggat
caaatcagaccattttgcgaagacgtgcacgaatggctttctcgtcatcaagaaaatgta
gctgtcgtacactgtaaggctggtaaaggtcggacgggtgtaatggtgtgttgttacctt
cttcatactaaacaatttcccactgccacagaagcccttaattactatggaaataaaaga
acacacgataggaagggggtaacaataccttcacagaggaggtatgtggattattatgct
actcttgtacaagaaggactagattatcaaccggttacattgttgttacgaaaaatacaa
ttggatccagcacctatttttcatggaggtcaaggatatttgcattgcgtaatatctgaa
tctaagaaaaaaatatttagctctgatatagtagaagtacgaaaaggaatgcacacagtc
agcatccctttaaaacacagcatagcattgacgggagatatacgagtggatttctttaat
agaccaaaaatgaagcgaaaggaaaaattgtttcatttttggttcaatacattcttcgta
cgagactacttatcgccggaatatgataatggagagttaccagttgagcgttcaactagg
gcattgagttgcgatggtgcaactatggaattaccagtggttatgtcgcacatgaaaccc
agagccggatccttagctagtctcggacctatgccacctactcttgttttaagtatagat
aaatggggtctggatgacgcacacaaggataaacatcacaaagtgtatagtgctgatttt
aaagttagcttatttatgcatcggatgggtggtaatatatcgcaaactgtatcagcgaca
acaaatagaacaggagagggtatacaaataggaatgggaggacaagataccccgagcgaa
tcaagcgaagcggatagcagtgaatgcgacacaactggtgatacgacgggagatgaagat
ggggaatctggtgagtcttctgcatctctggtggtgaatcaccaccctcttacacacagc
agtagccgtacacacgttagtatccaccaaagagctagtctcagagaaactgcaaaaggt
ttactctcgcatggggataaaagtagaagtagtcatcggcaaaacactggcaatgtgaaa
cgttcttcggctctcatacgttcggccacgttagacacataa

DBGET integrated database retrieval system