KEGG   Bombus terrestris (buff-tailed bumblebee): 100643608Help
Entry
100643608         CDS       T04364                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00052  Galactose metabolism
bter00500  Starch and sucrose metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100643608
   00500 Starch and sucrose metabolism
    100643608
Enzymes [BR:bter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100643608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Cyc-maltodext_C hDGE_amylase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 100643608
NCBI-ProteinID: XP_012164669
LinkDB All DBs
AA seq 575 aa AA seqDB search
MRALIVFCLTVLPLVAPYTWKPTAKYLSNSLVGASVYQIYPRSFKDSDGDGIGDLKGVIQ
KLDHLVDANVDIIWLSPIFSSPMVDFGYDISDFRNIYPTFGTIQDLEDLIREAHKVGIKV
LLDFVPNHTSDQHEWFQKSLKGIKPYSDYYIWHPGKVLENGTRVPPSNWVSIFGGSMWTW
RDERKAYYLHQFSKEQPDLDFFNPDVVQEMHEILRYWLKKGVDGFRIDALPFIGENMQFP
DEPLSGKTNDSTDPDYTDRIYTMHQQKGYDLIPGWRNVLNEFKQPKYMFTEAYANTSMTM
KYYKYEADFPFNFDLLQHVKSTANATTLKTVVDNWMKNMPTNSIPNWVVGNHDQRRLVSK
LGEPRARALTVMTLLLPGVSVTYNGDEIGMSDTFISWEDTQDPQGCMAGIQNYATSSRDP
ARTPFQWDDSVSAGFSTNTDTWLKVNDNYKTVNLAAEKKDKNSFYTLYKKVSTLRKSPYL
KGADLTTKVLSENVFAFARETKMGESVYTLINYSDKDDVVDLSAFENAPKKLDVFYATAK
STVLSKYRVGDIKKVKVPATAVIILTSPGIKTGYI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgctaatagtattctgcctaacggtattgcctctggtcgctccatacacatgg
aaaccgaccgcgaagtatttgagcaacagtttggtaggcgcatcggtctatcaaatctat
cccagaagtttcaaggacagcgatggagatggcattggcgatcttaaaggtgtcatacag
aagttggatcatctggttgatgcgaacgttgacataatttggttatcacccatttttagc
agccctatggtagatttcggctacgatatctcagatttccggaacatctaccccacattt
ggtactatacaggatttggaagacctgatccgagaagcgcacaaagtgggtataaaggtc
ttactggatttcgtcccgaaccatacgtcggatcagcacgaatggttccaaaagagcttg
aagggaattaagccttacagtgattattatatctggcatccaggaaaagtattggaaaat
ggcacccgtgtcccgccatccaattgggtgagcattttcggtggatcaatgtggacatgg
cgagatgaacgtaaggcgtattatctgcaccaattctcaaaggaacaacctgatctggac
ttctttaatccagatgtggtacaggagatgcatgaaattttgagatactggttgaagaaa
ggcgttgatggcttcagaatagatgccttgccatttattggcgagaacatgcaattccca
gatgaacctttgtcaggtaaaaccaacgattctactgatcctgactataccgataggata
tataccatgcatcagcaaaaaggttacgacttgatccctggatggagaaacgtcctgaat
gaatttaaacaaccaaaatacatgttcaccgaggcatacgcgaacacgtcgatgacgatg
aagtactataaatatgaagcagacttccccttcaattttgacctgcttcaacacgtcaag
tcgacagcgaacgcaacaaccttaaaaactgtggttgataattggatgaagaacatgccg
acaaatagcattcctaactgggtggtcggaaaccacgatcaaagacgattagtgtcgaaa
ttaggagaaccgcgagctcgtgctcttaccgtaatgacgcttctgttacctggcgtaagt
gtaacgtataacggtgacgaaatcggtatgtcggacacttttatcagttgggaagacaca
caggacccacagggttgcatggctggtatacaaaattatgctacttcgtctagagatccc
gcgagaacaccgttccaatgggatgactccgtttctgccggattctccacgaacaccgat
acttggctgaaagtcaacgataattacaagactgtcaatctggctgccgaaaagaaggat
aagaactcgttctataccctctacaagaaagtgtcaacgctgaggaagtcaccgtacctt
aaaggagccgacttaactacgaaggtgttgagtgaaaacgttttcgcgtttgccagggaa
accaagatgggtgaatctgtctacacgctaataaactactcggataaggacgacgtagtg
gatttatcagcattcgaaaacgcaccgaagaaattggatgtgttttacgctactgctaaa
tctactgtgctttctaagtacagggtcggagacatcaagaaagtaaaggttcctgccacg
gcagtgataatccttacttctccaggtatcaaaaccggatacatataa

DBGET integrated database retrieval system