KEGG   Bombus terrestris (buff-tailed bumblebee): 100644194Help
Entry
100644194         CDS       T04364                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00020  Citrate cycle (TCA cycle)
bter00190  Oxidative phosphorylation
bter01100  Metabolic pathways
bter01200  Carbon metabolism
Module
bter_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bter_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bter_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100644194
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100644194
Enzymes [BR:bter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100644194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 100644194
NCBI-ProteinID: XP_003402359
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MSSLLKLSSLLARNPPTTTLNKFGLPVITNRKLHYTPDGKAAKISDNVSKHYPLIDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYECNYFVEYFALDLLMEDGECRGVIALCLEDGT
LHRFHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGIPTNYKGQVLT
RKNDQDTVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTIAAENKPGEIIGP
LKPNAGEESVANLDWVRNANGSISTAELRLSMQKTMQTHAAVFRTAETLQEGCQKMSALY
NKLSDLKVSDKSMIWNSDLVESLELQNLMINAMQTIVAAENRKESRGAHAREDFKDRIDE
YDYSKPIGNQKPKSLDQHWRKHTLTKINPRTGEVSIEFRPVIDSTLDKQECATVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtcttttgaagctttcgtctttactggcgagaaaccctcccacaacgacgttg
aacaaatttggattaccagttattacaaatcgcaaacttcattatacaccagatggcaaa
gctgcaaaaatctcagacaatgtttctaagcattatccattaatagatcatacttatgat
gctgttgttgtgggtgctggtggagcaggattgcgtgcagcttatggcttagtcgctgaa
ggattcaaaacagcggtcattactaaactatttcctacaaggtcacatactgttgctgct
caaggaggtatcaatgctgcattaggtaatatggaggaagataactggcagtggcacatg
tatgacacagttaagggatctgactggttgggtgatcaggatgctattcattatatgaca
cgtgaagcaccaaaggcagtcattgaattggagaattgtggcatgcctttcagtcgaact
tcagatggtaaaatatatcaacgtgcttttggtggacaatccctgaaatttgggaaaggt
ggtcaagctcacagatgttgctgtgtagcagacagaacaggtcattctctacttcataca
ttatacggtcaatcattaagctatgagtgcaactattttgtcgaatactttgctctggat
ttactaatggaggatggagagtgcagaggtgtgattgctctttgtttggaggatggtaca
ctccatcgttttcatgctaaaaacacggtactagcaactggaggctatgggcgtgcatat
ttttcttgtacatctgctcatacatgcactggtgatggcactgcaatgatatctagagct
aatttgccaaatcaggacttggaatttgtgcaattccatcctactggaatatatggagct
ggttgcctcatcacagaaggcagtcgcggtgaaggaggctatctcgttaatagtgaaggt
gaaaggtttatggaacgttatgcaccagtcgcgaaagatttagcctctagggacgttgta
tctaggtctatgactatagaaatccgggaaggcagaggtgttggtccagagaaagatcat
atctatttgcaactccatcatttacctcctgaacagttagcagccaggctacctggtatt
tcagaaacagcaatgatatttgctggagttgatgtaacaagagaacctattcctgttata
cctacggtacattataatatgggaggaatacctacaaactacaaaggtcaggttctaaca
agaaaaaatgaccaggatacagttgtgcctggactatatgcctgtggagaatcagcttgc
gcatctgttcatggtgccaatcgtcttggtgcaaattcattattagatttagttgtgttt
ggtcgtgcttgtgctaaaacaatcgcagcggaaaataagccaggagaaattattggtcct
ctgaaacctaatgctggagaagaaagtgtagcaaatttggattgggttagaaatgcaaat
ggcagtatttctacggcagaattgagattaagcatgcagaaaactatgcaaacccatgca
gccgtattcagaacagctgaaacattacaagaaggctgtcagaagatgtctgctttatac
aacaagttgagcgatctgaaggtgtcggacaaatctatgatctggaattctgatcttgta
gagtctcttgaattacaaaacttaatgatcaatgctatgcaaacaatagtagctgcggaa
aataggaaagaaagtcgcggggctcatgcacgtgaagattttaaagatagaatcgatgaa
tacgattatagtaaaccgataggaaaccagaagcccaaatcactggatcaacattggcga
aaacacacacttacaaaaatcaacccccgaacaggcgaagtatctattgagttcagacca
gttatagatagtactctagataaacaagaatgtgcgacggttccacctgcaattcgttcc
tactag

DBGET integrated database retrieval system