KEGG   Bombus terrestris (buff-tailed bumblebee): 100644228Help
Entry
100644228         CDS       T04364                                 

Definition
(RefSeq) hexokinase type 2 isoform X3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00010  Glycolysis / Gluconeogenesis
bter00051  Fructose and mannose metabolism
bter00052  Galactose metabolism
bter00500  Starch and sucrose metabolism
bter00520  Amino sugar and nucleotide sugar metabolism
bter01100  Metabolic pathways
bter01200  Carbon metabolism
Module
bter_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bter_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100644228
   00051 Fructose and mannose metabolism
    100644228
   00052 Galactose metabolism
    100644228
   00500 Starch and sucrose metabolism
    100644228
   00520 Amino sugar and nucleotide sugar metabolism
    100644228
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100644228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bter04131]
    100644228
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100644228
Membrane trafficking [BR:bter04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100644228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100644228
NCBI-ProteinID: XP_003401409
LinkDB All DBs
AA seq 455 aa AA seqDB search
MKTSTLSSSDMIKQEIRDICKELILSNEQLHMVMQKLDDEMNKGLSKETHDQAVVKCFAT
YVQDLPDGSEKGHFLALDLGGTNFRVLLITLDHQNFDMKSKIYAIPQSLMLGTGTQLFDH
IAQCLALFVKDLNLHNERLPLGFTFSFPLSQQGLTKGYLVRWTKGFNCSGVVGEDVVALL
EKAIEKRKDVKIEVCAILNDTTGTLMSCAWKNRNCRIGLIVGTGTNACYVEKTSNVQCAI
PGNFSQEKPHMLINIEWGAFGEGGVLDFILTEFDRAIDENSINPSKQLFEKMISGMYMGE
LTRLVLEKVVNAGLLFGGKCPSDLKKRGKFFTKYVSEIENDAKGKYTNCREVLAELGLRN
VSDQDCENVRYVCSVVSRRAAHLASAGIATLLNKMGEDSVTVGIDGSVYRFHPYFHELMT
EKISQLQNYKFDLMLSEDGSGRGAALVAAVAAGHR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtcgacgttatcctccagtgacatgatcaaacaggagataagagatatctgc
aaggagctgatcctttccaacgaacagctccatatggttatgcaaaagttggacgatgag
atgaacaaaggtctatcgaaggaaacgcacgatcaggcggttgtgaaatgtttcgcgacc
tacgtccaagaccttcccgatggcagtgagaagggccactttctggccttggatctggga
gggacgaatttcagggtgctcttgatcaccttggatcaccagaatttcgacatgaagagc
aaaatctacgccataccacagagtctcatgttagggactggcacacagcttttcgatcat
atagctcagtgtttggcattgttcgtcaaggatctgaaccttcacaacgagcgtctacct
ctcggttttacgttcagcttcccattgtctcaacaaggactgaccaaaggctacctagtc
aggtggacgaagggttttaactgcagcggtgtagtcggcgaagacgtggttgctttgctc
gaaaaggcaatcgaaaaaagaaaagacgtgaaaatcgaggtatgcgccattctgaacgac
accactggtactctgatgtcgtgtgcttggaaaaacaggaattgtcgtatcggattgatc
gtcggaactggtaccaacgcctgttacgtggagaagacgtcgaacgtacaatgtgcgatt
ccaggaaacttctcgcaagagaagccacatatgctgatcaatatcgaatggggtgcgttc
ggtgagggtggtgtgctcgattttattctaacggagttcgatcgcgccatcgacgaaaat
tcgatcaatccgtcgaaacagttgtttgagaagatgatctcgggcatgtacatgggagaa
ttgacgaggttggttctcgagaaagtggtgaacgccgggctactgttcggtggaaagtgc
cccagcgatcttaagaaacggggcaaattcttcacgaaatacgtttcagaaatcgaaaac
gatgctaaagggaaatacacgaactgccgcgaagtactagcagaattaggattacgaaac
gtaagcgaccaggattgtgaaaacgttaggtacgtttgctctgttgtgtcgaggagagca
gctcacctggccagcgctggaatcgccacgttattgaacaaaatgggcgaagacagcgta
acagtcggaatcgatggttcggtctacagattccatccgtacttccacgagcttatgacc
gagaagataagccagttacagaattataagttcgatttaatgctctcggaggatggcagc
ggtcgtggtgcggcgctggtcgccgcagtggctgccggacaccggtga

DBGET integrated database retrieval system