KEGG   Bombus terrestris (buff-tailed bumblebee): 100646470Help
Entry
100646470         CDS       T04364                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bter01009]
    100646470
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bter03019]
    100646470
   04131 Membrane trafficking [BR:bter04131]
    100646470
   03036 Chromosome and associated proteins [BR:bter03036]
    100646470
Enzymes [BR:bter01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100646470
Protein phosphatases and associated proteins [BR:bter01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100646470
Messenger RNA biogenesis [BR:bter03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100646470
Membrane trafficking [BR:bter04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100646470
Chromosome and associated proteins [BR:bter03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100646470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP DUF604
Motif
Other DBs
NCBI-GeneID: 100646470
NCBI-ProteinID: XP_012166786
LinkDB All DBs
AA seq 1160 aa AA seqDB search
MSDSVICKNLHSAVKQLADSEIELIKAIENSEKINNRNIKNTMSMTDKKSAKKSAKMFNV
RPSAALIAAKHEATQRVLKGKKSNNVFVHDIYQKAIDAYNITRKETGIVFDRSMAEHKCL
WDPSYPECPARLTRVIQRCEELGLINRCKLVTPRQASEDEILMKHSQEQIDILKATDECT
DVDSLELLSSTYDAIYIHPSTYQLSLLAVGSTINLVESICKEEIQNGMAIIRPPGHHAMK
SEYCGYCFFNNVAIAAEKVLSSNLASKILIVDWDIHHGQATQQMFYNDPRVIYFSIHRYE
NGEFWPNLRESNFHFVGDGLGEGYNFNVPLNKTGMTNADYLAIFQQVLLPMAYEFQPDLI
IVSAGYDAALGCPEGEMLLTPACYAHLLSSLLSLAAGKVAVILEGGYCLKSLAESAALTL
RTLLGDPCPMLETLTLPSISVRDTILNTIYAHKPYWKCYQYQDTYSINSTTNNKEGSTNQ
YLPVVTFKGTDIKPEVYETRNCYPTQNKEVIEMIEKQLNTLIQFINLSKAPNKVCIVYDD
RMLKHCDMFNDNHPEKPHRINIIYKKYQEYNLLDRCYVQQGRSATREELILVHSKEYIDS
IKDTENLKPKELKKQAETYNSVYLHPETWTSACISTGSLLQVVDSVLNGESQSGIAIVRP
PGHHAGENIACGFCIFNNIAIAAKYAVEFHHVKRVLIVDWDVHHGNGTQSIFEEDPKVLY
ISVHRYDNGNFFPNSKRANYSYVGSLSGEGFTVNIPWNKKGMGDAEYIAAFQQIIMPIAY
QFNPELVLVSAGFDACIGDPLGGCFVTPEMYGHLTHWLSSLANGRIILSLEGGYNINSIA
HAMAICTKSLLGDPLPILENGQTPCASAIHTINNVIKTQKQYWTHLVFNLSLPKERVLPK
PKVPHIKTNERVINSEKILKHSESKIALEEIETEKMQTRQKNLTTWKLINKMASQEDCEK
LQEFLKSVHERRTHTTINTSYNDEGSKYTKKCMNQDEEEGHSDENITNFAAGSSGEQGER
ASAQMTGNKSLHDYLLENSQALVDGDMFAVIPLRECPHLNSVKDVPVSGIDIYSPCIECE
SNVENWICLQCYTVHCARSINQHGLIHAEEMEHPLALSFSDLSVWCYKCEAYIDNLRLFA
ARNAAHQSKFNEELPWTYEI
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactctgtgatctgcaaaaatttacactctgctgttaaacaattagcagacagt
gaaatcgagttaataaaagctatagaaaattcagaaaagataaataacagaaatattaaa
aatactatgtctatgacagataagaaaagtgccaaaaagtctgcaaaaatgtttaatgtt
cgtccatctgctgctttaatagcagctaaacatgaagcaacacaacgtgtattaaaagga
aagaaatctaacaatgtttttgtacatgatatatatcaaaaagctattgatgcatataat
ataacaaggaaggaaactggcattgtgtttgatcgttctatggcagaacataaatgtctt
tgggatccaagttatccagaatgtcctgctagattgacaagagttatacagagatgtgag
gagttaggtttaataaatagatgtaaattggttacaccaagacaagcctcagaggatgaa
atactaatgaagcacagccaagaacagatagatattttgaaggctactgatgaatgtaca
gatgtagatagtttagaattattatcatcaacatatgatgccatttatatacatccttct
acctatcaattgtctttgttagctgtgggttcaacaataaatttagtggaaagcatttgc
aaagaagaaattcagaatggtatggctattataaggccaccaggacatcatgcaatgaaa
tcagaatattgtggatattgtttcttcaataatgttgcaattgccgctgaaaaagtttta
agtagcaatttagctagtaaaattttgattgttgattgggatatacaccatggacaagct
actcagcaaatgttctataatgatccacgagtaatttatttttcaattcaccgttatgaa
aatggtgaattttggccaaatcttagagaatctaatttccattttgttggagatggttta
ggagaaggatataattttaatgtgccacttaataaaactggcatgaccaatgctgattat
ttagccatatttcaacaagttttattgccaatggcctatgagtttcaacctgatctcata
atagtatcagctggatatgatgcagccttgggctgtcctgagggtgaaatgttgctaaca
cctgcgtgttatgctcatttactatcatcattattgagtttagccgctgggaaagttgct
gttatattggagggtggttattgtttaaaatcattagcagaaagtgcagcattaacatta
cgtactttgttaggtgatccatgtcctatgttagaaactcttacattaccttcaataagt
gtacgtgataccattttaaatacaatttatgcacataaaccatattggaaatgctatcaa
taccaagatacatacagtattaatagtacaacaaataataaagaaggaagtactaatcaa
tatttacctgtagttacattcaaaggaactgatattaagcctgaagtgtacgagactcga
aattgttatccaactcaaaataaagaagttatcgaaatgatagaaaagcagttaaataca
ttaatacagtttattaacttatctaaagcacctaacaaagtgtgcattgtttatgatgat
agaatgttaaaacattgtgatatgtttaatgataatcatccagaaaaaccacatcgtatt
aatattatttataaaaaatatcaagagtacaatttacttgatcggtgttatgtgcaacag
ggacgaagtgcaacaagagaagaattaatattagttcattcaaaagaatatatagattca
ataaaagacacagaaaacttaaaaccaaaagagctaaaaaagcaggcagaaacttataat
tcagtttatttgcatcctgaaacgtggacaagtgcttgtatatcaactggatcattatta
caagtagttgatagcgtattaaatggagaaagtcaatccggtattgctattgttaggcct
ccagggcatcatgctggagagaatatagcatgtggtttttgtatttttaacaatattgct
atagcagctaaatatgcggtagaattccatcatgtaaaaagagtattgatagtagattgg
gatgtacatcatggtaatggaactcaatccatctttgaggaagaccctaaagttttgtat
atatctgtccatcgttatgataatggcaatttttttccaaattctaaacgagcaaattac
tcttatgtcggttctctatcaggagaaggtttcactgttaacattccatggaataagaaa
ggaatgggcgatgcagaatatatagcagcatttcaacagataataatgccaattgcttat
cagtttaatccagaattagtcttagtttctgcgggttttgatgcatgtattggggatcct
ctaggaggttgtttcgtaacaccagaaatgtacggacacttaacacattggctatcttct
ttagctaatggtcgtattattcttagtcttgaaggaggttacaatattaattcaatcgcg
catgcaatggctatttgcacaaaatctttgcttggtgatcctttaccgatattagagaat
ggacaaactccatgcgcgagcgctattcacactataaataatgttataaaaacacaaaaa
caatattggacacatttagtatttaatttatctttaccgaaagagagagtacttcctaag
cccaaagttccacatataaagacaaatgaacgtgtcataaacagtgaaaaaatattaaag
cattcagaatctaagatagcattggaagaaatagaaacagaaaaaatgcaaactaggcag
aaaaaccttacaacttggaagttgataaataaaatggcctcacaagaagattgtgagaaa
ttacaagagtttcttaaatctgtacatgagcgacgtacacatacaacaattaatacttct
tataacgacgaaggttccaagtatacaaagaagtgcatgaatcaggacgaagaagaagga
cattctgatgaaaatattaccaattttgctgctggtagtagtggtgaacaaggcgaaaga
gcaagtgcgcaaatgactggaaataaaagtttacatgattatttgttggaaaattcgcaa
gcattagtggatggagacatgtttgcagtgatacctttacgagaatgcccacatttgaat
agtgtcaaggatgtaccagtttctggaattgatatatattcaccatgtatagaatgtgaa
agcaatgttgaaaactggatctgtttacagtgttatactgttcattgtgctcgtagtatt
aatcaacatggtttaatacacgctgaagaaatggaacatccattggccctaagtttcagt
gatttatcagtttggtgttacaaatgtgaggcatacatagataatctgcgattatttgcc
gcgcgcaatgctgcacatcaaagtaaatttaatgaggaattaccatggacgtatgaaata
taa

DBGET integrated database retrieval system