KEGG   Bombus terrestris (buff-tailed bumblebee): 100648118
Entry
100648118         CDS       T04364                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X3
  KO
K20017  Bcl-2 family protein
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04214  Apoptosis - fly
bter04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:bter00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100648118
   04215 Apoptosis - multiple species
    100648118
SSDB
Motif
Pfam: Bcl-2 QueF HTH_Tnp_Tc3_2
Other DBs
NCBI-GeneID: 100648118
NCBI-ProteinID: XP_003402850
UniProt: A0A6P3DLL4
LinkDB
Position
Unknown
AA seq 283 aa
MSGLVGSLRGLEDNSGNTGQPYRRHSLALSLHSNLAAFPLPNNQEASPFHVVDSARRRFS
NVSDVVSRKISHTIRWRTVSASIELTVSQGSSLCAQYIRNRLKRSGIFHRKLGLKRMRSA
MLLPGGAIVGEVYPELVSVGAELEKMHPNLFNRVARQIGCGSFSSEQSASEAIADISREM
IRNGEMTWSKVIALYAVAGGIAVDCVRQGKPEYLPAIQRGMTDVLEEDLATWIQANGGWS
ALATRYRPVTKETMWYSRKLIFLFLFTVLLIFMISIFLKFVVL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgtctgggctcgtcggatctttacgtggcttggaggataatagtgggaacacagggcaa
ccgtatcgtaggcacagcctcgctttatctctccactcgaatttggccgcttttccgctt
cctaacaatcaagaagcttcgccttttcacgtcgtcgattcagcacgaagaagattcagt
aatgtcagcgacgttgtttccagaaagatttctcatacgattcgatggagaacggtttca
gcttcgatcgagctcacagtatcacagggatcgtcgttatgtgctcaatatatccgaaat
cgtttaaaacgatctggaatttttcaccgaaagctgggtctgaaaagaatgagaagcgcc
atgttgcttcctggaggtgcaatcgttggtgaagtttatccagaattagtatcagttgga
gctgaactagaaaagatgcatccaaatttgttcaatcgtgttgcacgacaaatcggttgt
ggtagtttctcatcggaacagtctgccagcgaggccattgccgatatctccagggaaatg
atcaggaatggagaaatgacttggagcaaagtgatagccctttacgcggttgctggtggt
attgctgtagattgcgtacgtcagggtaaacccgagtatttacctgctatacagagaggt
atgacggatgtattagaagaagaccttgcaacatggatacaagctaacggtggatggtcc
gctttagcaacacgatacagacctgttacaaaagaaacaatgtggtattcacgaaaactt
atatttttatttttattcacagtcttgctcatttttatgatctccatatttttaaaattt
gtagttttataa

DBGET integrated database retrieval system