KEGG   Bombus terrestris (buff-tailed bumblebee): 100648639Help
Entry
100648639         CDS       T04364                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00250  Alanine, aspartate and glutamate metabolism
bter00280  Valine, leucine and isoleucine degradation
bter00410  beta-Alanine metabolism
bter00640  Propanoate metabolism
bter00650  Butanoate metabolism
bter01100  Metabolic pathways
Module
bter_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    100648639
   00650 Butanoate metabolism
    100648639
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100648639
   00280 Valine, leucine and isoleucine degradation
    100648639
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100648639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bter01007]
    100648639
Enzymes [BR:bter01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     100648639
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     100648639
Amino acid related enzymes [BR:bter01007]
 Aminotransferase (transaminase)
  Class III
   100648639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100648639
NCBI-ProteinID: XP_003397486
LinkDB All DBs
AA seq 498 aa AA seqDB search
MLANKCQPALFTRKFSRQLFKGYAISWERCLTVSVEEPKKPMVTTEIPGPRSRSLLQELT
SMQQASSVQFFADYEKSVGNYIMDVDGNILLDVYMQISSMPLGYNHPAMLKALADPVNQK
IIANRPALGVFPGKDWPDKLRNILLHKEIAPPGLSHITTMMCGSCSNENAFKTIFIWYAE
KQREDAPFTREEMESCMMNQTPGAPRFSILSFKGAFHGRTLGSLSTTHSKYIHKIDIPAF
DWPTASFPVYKYPLNENIRENQQEDNRCLAEVEELFEKYKTEKKIPVAGVIVEPIQAEGG
DNHASPEFFQELQRITKKHDAALLIDEVQTGGGPTGKMWCHEHFNLESPPDLVTFSKKMQ
LGGYYHVKSLKPKQSYRIFNTWMGDPSKMILLEAVLETIRKENLLHRVTTVGDYMLKQLT
SLQNEFSTMINSIRGRGTFIAFNCSSPQLRDTIIKKLLSKGIQTGSCGTSTIRLRPALTF
TEHHANIFLDTLRSILKQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctaacaagtgtcaacctgcgctctttactcgaaaattttcacggcagttattc
aaagggtatgcaatatcttgggagagatgcttgaccgtatccgtagaggaaccaaaaaag
cctatggtaacaacagaaataccaggacctcgatctcgtagtttattgcaggaactcact
tcgatgcaacaagcctcttccgtacaattcttcgccgactacgaaaaatcagtaggtaac
tatataatggacgtcgatgggaatattctgcttgatgtttatatgcaaatttcgtcgatg
cctctgggctacaatcatccagctatgttaaaagctctcgctgatccggttaatcagaaa
attatagcaaataggcctgcgttaggtgtttttcctggaaaggattggccagataaactg
aggaacattttgctacataaagagattgccccaccaggattgtctcacatcacgactatg
atgtgtggttcttgttcgaatgaaaatgcatttaaaacaatttttatttggtatgctgaa
aaacaaagggaagatgctccgttcacgagagaggaaatggaaagttgtatgatgaatcaa
acacctggtgctccgcgattttcgatactttcgttcaaaggtgcatttcatggacgaaca
ttgggatctctgtcaacaacgcacagcaaatacattcataaaatagatattccagcgttt
gattggcccaccgcgtcctttcccgtatataaatatcccttaaatgaaaatatccgagaa
aatcagcaagaagataatcgatgtctagccgaagtagaggaattattcgaaaagtacaaa
actgagaagaaaattccagttgctggtgtgatagttgaaccaattcaagcggaaggaggt
gataatcacgcatctcctgaattttttcaagaattacagcgtataacaaaaaaacacgat
gcggcattattaatcgatgaagtacaaactgggggcggaccaacaggaaaaatgtggtgt
catgaacatttcaatttagaatctcctccagatttggtgacctttagcaaaaaaatgcaa
ttgggcggctattaccatgtcaaatctttaaaacctaagcaatcctaccgtatattcaac
acctggatgggagatcccagcaaaatgatattactcgaagcagtattagagacgattagg
aaggaaaatcttttgcatagggttacgactgttggcgattatatgctaaaacaattgacg
agtttgcaaaatgaattttccacgatgattaattcgatacgtggacgtggaacgttcatt
gcatttaactgctcttcgcctcaattacgggatacgataattaagaaacttttaagcaaa
ggtattcaaaccggtagctgtggtacttcgacgataaggttaaggcctgccttgacattc
acggaacatcatgcgaatatattcttagatactctgcgatctatattaaaacaataa

DBGET integrated database retrieval system