KEGG   Bombus terrestris (buff-tailed bumblebee): 100648793Help
Entry
100648793         CDS       T04364                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00010  Glycolysis / Gluconeogenesis
bter00030  Pentose phosphate pathway
bter00051  Fructose and mannose metabolism
bter00052  Galactose metabolism
bter01100  Metabolic pathways
bter01200  Carbon metabolism
bter01230  Biosynthesis of amino acids
bter03018  RNA degradation
Module
bter_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100648793
   00030 Pentose phosphate pathway
    100648793
   00051 Fructose and mannose metabolism
    100648793
   00052 Galactose metabolism
    100648793
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100648793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bter01009]
    100648793
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bter03019]
    100648793
Enzymes [BR:bter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100648793
Protein phosphatases and associated proteins [BR:bter01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100648793
Messenger RNA biogenesis [BR:bter03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100648793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100648793
NCBI-ProteinID: XP_003398545
LinkDB All DBs
AA seq 796 aa AA seqDB search
MAEEIAAQRFIKPGSHKGKGLAVFTSGGDSQGMNAAVRAVVRMGIYLGCKVFFINEGYQG
MVDGGSNIVEANWSSVSCIIHRGGTVIGSARCKDFRERAGRRKAAKNLVTRGIANLVVIG
GDGSLTGANLFKEEWSDLLKELAEAGEITSEQAEKYQHLHIAGMVGSIDNDFCGTDMTIG
TDSALHRIIESIDAIVSTAYSHQRTFIMEVMGRHCGYLALVAAICSEADYVFIPEWPPEQ
DWPNKLCKKLLQERLTGQRLNIIIVAEGAIDRNGQPITAEKVHKVVVDKLQQDTRITVLG
HVQRGGNPSAFDRVLGCRMGAEAVMALMEAKPDTEACVVTLDGNQAVRLPLMECVRRTKA
VAQAMADKNWDLAVQLRGKGFARNLDTYKMLTRLKAPVDHDPSKESNGPILKKQHYTLGV
MHIGSPSCGMNAAVRSFVRNCIYRGDKVYGICDGIMGLMAGKFKLMDWPSVTGWVAQGGA
YLGTKRAPPKEEQLPQIAQRLKEYGIQALLIIGGFEGYQTGLTFFKARDKYEEFRIPIAM
IPATISNNVPGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVFIIETMGGYCGYLATVA
GLAGGADAAYIFEEKFNIKDLNQDVIAMAAKMSEGVQRGLILRNENANLNYNTDFMQRLF
SEEGKGLFSCRMNIIGHMQQGGSPTPFDRNLGTKMGSKAVEWFTEQLKKYSSDGSKVTTM
DADSAVMIGIVRRQYRFTPFTELIEVTDFEHRIPTYQWWMKLRPLLKVLAKHESTYEEEG
LYITVEEMDLDNDPLV
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaatagcagcacagaggtttataaaacctggtagtcataaaggtaaaggc
cttgcagtctttactagcggaggtgactctcaaggaatgaatgctgcagtccgagcagtt
gtcagaatgggtatttacctaggttgtaaagtttttttcatcaatgaaggctatcagggt
atggtggatggtgggagtaacattgtagaagctaattggtcatctgtctcttgtatcatt
catagaggtggtacagtaataggatctgctcgttgcaaagattttagggaacgtgctggt
cgtaggaaagctgcaaaaaatttagtaactcgtggaatagctaacttggttgtaataggt
ggtgatggttcccttactggtgcaaatttatttaaagaggaatggtcagatctattaaaa
gaattagctgaagcaggtgaaattacttcagaacaggcagaaaaataccaacatttacat
attgctggtatggtaggttctatcgataatgatttttgtgggacagacatgactattggt
accgattcagcattacatcgtattattgagagtattgatgctattgttagtactgcatat
tctcatcaaagaacattcataatggaagtcatgggtcgacattgcggttacctggctcta
gtggcagccatatgttccgaagctgattatgtgttcatcccagagtggccacctgaacag
gattggccaaacaagctgtgcaaaaagctattacaggaaagactcacaggacaacgactt
aacattattattgtggcagaaggcgcaatagatagaaacggccaaccaattactgctgag
aaggttcataaagttgttgtagacaaactgcaacaagatacaaggattacagttcttggt
catgttcaaagaggtggtaatccatcagcttttgatagagtactgggttgtcgaatggga
gcagaagcagtaatggcattgatggaagcgaaaccagacactgaagcatgtgttgttaca
ctggatggtaatcaagctgttagattacctcttatggagtgcgttcgtcgtactaaagca
gtagcacaagctatggctgataaaaattgggatcttgctgttcaacttcgtggaaaggga
tttgctcgtaatttggatacatataaaatgttaacccgtttgaaagcacctgtagatcat
gaccctagtaaggaaagtaatggcccgatattaaaaaagcaacactatacgttaggtgtg
atgcatattggttcaccttcttgtggtatgaatgctgcggtgcgttctttcgttcggaac
tgtatatatcgaggtgataaggtatatggtatttgcgacggaataatgggccttatggct
ggaaaatttaaattgatggattggccttctgtcactggttgggtagcacaaggtggtgct
tatttaggaactaaacgtgctccacccaaagaggagcagttgcctcaaattgcccagaga
cttaaagaatacggaattcaagctttgctcatcataggagggtttgagggttatcaaaca
ggacttacctttttcaaagctagggacaagtatgaagaatttcgaattcctattgctatg
attccggcaactattagcaataacgttccaggaaccgagttttcattaggttgtgacaca
gctttaaatgaaattacagagatctgtgatcgaattcgtcaatcggcacaaggtacaaag
cgtcgagtatttattattgaaactatgggtggatactgcggttatttagctacggtcgct
ggattagccggaggtgctgacgcagcatatattttcgaagagaagtttaatattaaagac
ttaaatcaagatgtcattgcgatggcagcaaaaatgtctgaaggtgtacagagaggtctt
attttgagaaatgaaaatgctaacttgaattataatacagattttatgcagagacttttt
agcgaagaaggaaagggtctattcagctgtagaatgaacattattggtcacatgcaacaa
ggtggttcaccgactccatttgatcgcaatttgggtacaaaaatggggtctaaggcagtt
gagtggtttaccgaacaattaaaaaaatatagtagtgatggcagtaaggtaacgacgatg
gatgctgatagtgccgttatgattggtattgtgcgaagacagtatagatttacgccgttt
acagaacttattgaagttacggatttcgaacaccgcattccgacatatcagtggtggatg
aaattgcggccattactcaaagttttagcaaaacatgagtctacatatgaggaagaagga
ctttatatcactgtagaagaaatggatcttgataacgatcctcttgtataa

DBGET integrated database retrieval system