KEGG   Bombus terrestris (buff-tailed bumblebee): 100650198Help
Entry
100650198         CDS       T04364                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bter00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100650198
Enzymes [BR:bter01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100650198
Chromosome and associated proteins [BR:bter03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100650198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 100650198
NCBI-ProteinID: XP_003395472
LinkDB All DBs
AA seq 1332 aa AA seqDB search
MELRLHSPAGAEPIVYQWPLTSGSGSDRHDGALDVVETMRWVCEDLPDLKLPLENNILCD
YDTRDYESMKNLCDKFNRAIDSLVQLEKGTSLPSQRLNKRPSRGLLRHILQQTYNQAVVE
PDKLNQYEPFSPEVYGETSYELVCQMIDQIDVTEDDVFVDLGSGVGQVVLQMAAATLCKI
CIGVERADVPSRYAQSMEVNFRKWLNWYGKRCGEYRLVKGDFLADEHRESITGATIVFVN
NFAFGPTVDHQLKERFADLRDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMSPLKG
SVSWTGKPVSYYLHVIDRTKLERYFHRLKNNKQGGDENSDSVINNTANNNNKVTNRGERG
DRAKRDLSRQLESPNHSEQQGTNSDSDADENNIKNRRQSTKIRRKISRKSSSIRPPARGR
QRGRGVKKSKPKKAINISGLDLLHSQTLLSTSPQALGKKPPPAPGCVDQQLSSLSLSLQS
HSTSVHEELSIPPAPSATPYALQILLDLYRDQFMLMLESMRTPSYRVSVNTDIAKERERN
SKLQSRAAQLEKQIKVLIDDSVALLKARMTELGINATSPGDLLAKAKEIVLRHKQLQAKA
SKLQAQVASMENEQSRLTALRHQELQEKYSSLTNTNGISNPSQPLTQDYILKEISATLSQ
RKRLHCQVSKLEHELNVLERANNEKQVAAIAQQQREALGSKHSQSQHHQQQQNGKSGSSR
KNREGRSRSQEWPDVPDIGKIQENNPEILAQKILETGRQIEAGRILNRQNSSTSTNSRTR
LPQASLSFSTTSPSISSSQSQINNKETTNRTQEPPRVANFEDRLKSIITSVLNEDQQNRN
KQQQMQLQVQLQNQTEQDRKRITLPQNVSTPDYTQVSPAKLALRRHLSQERLSSHLTPSD
RPTIDSRQSSHDNRIVAGGNGLLGTRTIGDLVSGEIERTLEISNQSIINAAVDMSAIVRP
ENVYSPISRPASAEGDAGLSTLAHVASYAPTSSAISTCTPTTTSRSSVLFTPVAQPQRYT
PVQLPRADIKPYHESYFSDNPSQSLTQAHPPPSLHTSQATSTGELLPVEGLAASLHARIL
NNHNTKTEPILTTNRRFQPYPRYATSSNSNSSTTTNGMVTAICQSQPSMSLKTEAVVSSV
STSGAPLSPLVEPHSNTSTPLVDEPQMTTQRQRNGIGDDDGEADWQDRISSGFDRLVAFA
STELDKRRRSTEGVNTSPDSGLGSDSTVTGPPPVIPSPDEALGPPRTPSPTSPRPPNPSN
SSSTSSNSSSSSSTSSVPLKYQRHPDPERHHFKKKFFHRDWNNSGSTSKFRPKGKDWDWN
HSGQWPSNDEQS
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcgcctgcactcgccagccggagcagaaccgatcgtctatcaatggcccctc
acctccggatccggatctgatcgtcatgatggtgcacttgatgttgttgaaacaatgaga
tgggtttgtgaggatttgccagatctaaagctaccattagaaaataacattttatgtgat
tatgacacaagagattatgaaagtatgaaaaatttatgtgacaaatttaatagagcaatt
gatagtttagttcagctggagaaaggcactagtttaccatctcaaagattgaataaaaga
cctagtcgaggtttacttaggcatatacttcagcaaacatataatcaagcagtagtggaa
ccagacaaattaaatcagtacgagccattttcaccagaagtatatggagaaacaagttat
gaacttgtgtgtcaaatgattgatcaaattgatgtaacagaagatgatgtatttgttgac
ttgggatctggagttggacaagtggttcttcaaatggctgcagcaactttatgcaaaatt
tgtattggagttgaaagagctgatgtaccatcaagatatgcacagagtatggaagtaaac
tttcgtaaatggttgaattggtatgggaaaagatgcggtgaatatcgtttggtaaaaggc
gattttttagctgatgaacatcgtgaaagcattactggagctacgatagtgtttgttaat
aattttgcatttggtccaacggtggatcatcaactgaaagaacgatttgctgatttacgg
gacggagcacgaatcgtatcgtcaaaatcattttgccccctcaactttcgcataacggat
agaaatctcagtgatattggtacgataatgcatgtatcagagatgtcaccactaaagggt
tctgtctcgtggactggtaaaccggtgtcttattatttacatgtaattgatcgtactaag
ttagaacgttatttccaccgcttaaagaataacaagcaaggtggcgatgaaaattctgat
tctgtgataaataacactgccaacaataacaataaggttacaaatagaggtgaaagaggt
gatagagctaaacgggatctttcaaggcagttagaaagtccgaatcattcggagcaacaa
ggaacaaatagcgattctgatgcagatgaaaataacattaaaaatcgtcggcaatcaact
aagatccgtagaaaaataagtaggaaatcaagtagtataagacccccggctagaggcaga
cagaggggaagaggcgtaaagaaatcaaagcccaagaaagcaattaatatttctggtttg
gacttactgcatagtcaaacattactgagtacatctccgcaagctttgggaaagaaacca
ccgcccgcgcctggttgtgtggatcaacaactgtcttcattatcactttcattacagtca
cattccacctctgtgcatgaagaacttagtataccacctgctccgtccgccactccgtac
gcattacaaatacttttggacttgtacagggaccaatttatgctcatgttagaatcaatg
agaactccttcgtacagagtgtcagtcaatacagatattgcaaaagaaagagaaagaaat
tcaaagttacaatcgagagcggcgcaattagaaaaacaaataaaggtattaattgatgat
agtgtagcacttttaaaagcaagaatgaccgagctaggtataaatgcgacatcgcctgga
gatttacttgcaaaggctaaggagatagttcttagacacaaacagttgcaagctaaagca
agtaagctacaggcccaggttgcatctatggaaaatgaacaatcgagattaactgcgctt
agacatcaagaattacaagaaaagtatagtagtctcacaaatacgaatggcatatcaaat
ccatcacaaccacttactcaggattacatattgaaagaaatttctgcaactttgtctcaa
cgtaaaagattacattgtcaggtatccaaattggaacatgaactaaatgttttggaaaga
gcaaataatgaaaaacaagttgctgcaatagctcagcaacaaagagaggcactgggttct
aaacactcacaaagtcaacatcatcagcagcagcaaaatggaaagagcggatcatcacga
aaaaatagagaaggacgttctagatcgcaagaatggcctgatgttcctgatattgggaaa
atacaggaaaataatccagaaatattggcgcaaaagatcttggaaactggcagacaaata
gaagctggtcgaatattaaacagacaaaatagtagtaccagtactaattctagaaccaga
ctgccacaagcatctctcagtttttctactacttcaccatctatttcatcctcacaatcg
caaataaataataaggagacaacaaatagaactcaggaacctcctagggttgcaaatttc
gaagataggttaaagagtatcattacgagtgttttaaatgaagatcaacaaaatagaaat
aagcaacaacaaatgcaactacaggtgcaattacaaaatcagactgagcaagatagaaaa
cgtattacattgccacaaaatgtttctactcctgattatacacaggtttcacctgcgaag
ttagcacttcgtcgtcacctctctcaagaacgtctttcctctcatttaacaccatctgat
agaccaacaatcgactcgaggcaatcgagtcatgataatcgtattgtagcaggaggaaat
ggattgcttggcactagaacaattggtgatttggtcagtggagaaatagagagaacgcta
gaaatatccaaccaatctataataaatgctgctgttgatatgagcgcaattgtaaggcca
gaaaatgtatattctcctatcagtagaccagctagtgcagaaggtgatgctggcttatca
actctagcgcacgtagcaagttacgctccaacttcttctgctatttcaacatgtactcct
accactacttcaagatcatctgtgttatttactccagtagcacaaccacaaagatacaca
ccagtccaattacctcgtgcagatatcaaaccttatcatgaatcgtatttctctgacaat
ccttctcagtcactcacacaggcccatccgccaccgtcattacatacatcacaggcaaca
tcaaccggcgagcttttgccagtagaaggactagctgcatctttacatgctcgtatttta
aataatcacaacacaaaaactgagccaatactgactacaaatagaagatttcaaccatat
cctcgatatgcaactagtagcaacagtaatagcagtacaacaacaaatggtatggtgaca
gccatttgtcaatcacaaccttcgatgtcactaaaaacggaggcagtggtatcatcagta
agcacaagcggagcgccattgagtcctctcgtggaaccacattctaatacgtccacgccg
ctagttgatgagccccaaatgacaacgcagagacaacgaaatggtattggcgatgacgac
ggagaagcggattggcaagatcgtatcagttctggatttgatagactggttgcatttgca
tcgacggagttggataagcgaagaagatctacagagggagtaaatacaagtcctgacagt
ggtttaggatcggacagcacggtgacgggacctccaccggtgattccgtcgccagatgaa
gcactgggacctccacgtacaccttcaccgaccagtcctcgcccaccgaatccctccaac
agtagtagtacgagcagtaacagcagtagtagcagtagcacatcttcggtgcctctaaaa
tatcaacgtcatccagatccggaacgacatcattttaagaaaaagttttttcatagagat
tggaataactctgggagtaccagtaagtttcgtcctaaaggcaaagattgggattggaat
cattcaggacaatggccttcgaatgacgaacaatcttaa

DBGET integrated database retrieval system