KEGG   Bombus terrestris (buff-tailed bumblebee): 100650322Help
Entry
100650322         CDS       T04364                                 

Definition
(RefSeq) UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform X1
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100650322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bter01003]
    100650322
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bter03036]
    100650322
Enzymes [BR:bter01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     100650322
Glycosyltransferases [BR:bter01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   100650322
Chromosome and associated proteins [BR:bter03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     100650322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_17 TPR_8 TPR_12 TPR_14 TPR_16 TPR_19 TPR_7 TPR_10 TPR_9 NARP1 TPR_6 TPR_MalT FAT TPR_15 EST1_DNA_bind TPR_3 TPR_21 DUF4314
Motif
Other DBs
NCBI-GeneID: 100650322
NCBI-ProteinID: XP_003396454
LinkDB All DBs
AA seq 1095 aa AA seqDB search
MSIRLAEKKENVIKNSTGIIGNVVNSSDDVCNGTVEWQNGQNLLVVTQDTQGKELIAITD
NQTINVAVDSYWLLELAHREYQAGDYENAERHCMQLWRQETNNTGVLLLLSSIHFQCRRL
EKSAHYSSLAIKQNPLLAEAYSNLGNVYKERGQLQEALENYRHAVRLKPDFIDGYINLAA
ALVAAGDMEQAVQAYVTALQYNPDLYCVRSDLGNLLKALARLDEAKACYLKAIETRPDFA
VAWSNLGCVFNAQGEIWLAIHHFEKAVALDPNFLDAYINLGNVLKEARIFDRAVAAYLRA
LNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVVE
AEDCYNTALRLCPSHADSLNNLANIKREQGYIEEATRLYLKALEVFPEFAAAHSNLASVL
QQQGKLNEALMHYKEAIRIQPTFADAYSNMGNTLKEMQDIQGALQCYTRAIQINPAFADA
HSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYEARMKKLVS
IVAEQLDKNRLPSVHPHHSMLYPLSHEFRKAIAARHANLCIEKIHVLHKQPYKYPREIGA
RLKIGYVSSDFGNHPTSHLMQSIPGLHERQNVEIFCYALSADDGTTFRAKIAREAEHFVD
LSQIPCNGKAADRINADGIHILVNMNGYTKGARNEIFALRPAPVQVMWLGYPGTSGASFM
DYLITDEVTSPLELANQYSEKLAYMPHTYFIGDHKQMFPHLKERLILTDKLNMKGKVADN
VAVINATDLSPMIENTCVKEIREVVVPDAENKPVEISLKVAELPTTTPIETMIASGQCQM
SVNGVVVQNGMATTQVNNKTATGEEVPQNIMITTRQQYGLPEDAVVYCNFNQLYKIDPLT
LHMWAHILKHVPNSVLWLLRFPAVGEPNLQATAQQLGLAPGRILFSNVAAKEEHVRRGQL
ADVCLDTPLCNGHTTSMDVLWTGTPVVTLPGETLASRVAASQLNTLGCPELIARTRQEYQ
DIAIRLGTDREYLKATRAKVWKARSESPLFNCKLYAVGMEMLYKKMWERFARGEKPDHVS
AVDKTEMQKLLAAAS
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgagtataagactggcagagaagaaagaaaacgtaataaaaaattcgaccggcataatt
ggaaacgtagtcaatagttcggatgacgtttgtaatggaaccgtcgagtggcaaaatgga
cagaatcttctagttgttacacaagatacgcaaggcaaagaactaattgcaatcactgat
aatcaaaccattaacgttgcagttgactcctattggctactggaacttgctcatagagag
tatcaggccggagattatgaaaatgcagaaagacattgtatgcaactctggaggcaagaa
acaaataacacaggagttcttctattattgtcttctattcattttcaatgtagaaggcta
gaaaaatctgcacattacagtagcttagcaataaagcaaaatcctttattggcagaggct
tacagcaatcttggaaatgtttacaaggaacgtggccaactacaggaagctttggaaaac
tatcgacatgctgttagattgaaaccagatttcattgatggttacatcaatctagcagct
gcattagtagctgcaggagatatggaacaagcagttcaagcatatgtaactgctctacaa
tataaccctgatctttactgtgtgagaagcgatctcggtaatcttttgaaagcattagca
agacttgatgaagccaaggcttgctatctaaaggcgattgaaacgcgtccagacttcgca
gtcgcatggagcaatcttggctgtgtattcaacgctcaaggcgagatttggttggcgatc
catcactttgagaaggccgtagctttggacccaaatttcctggatgcctacatcaatctt
ggcaatgtactcaaagaggctagaatctttgatagagctgtagctgcttatctgcgtgct
ttgaatctcagtcctaacaatgcagtcgtacatggaaatctggcgtgtgtctactatgaa
caagggcttatcgatttggcgattgatacatatcgtcgtgctattgaactacaaccaaat
ttcccagatgcttactgcaatttggcgaacgcgctcaaggaaaagggacaagtggtcgag
gctgaggattgctataatacggctctccgcctctgcccctcacatgccgattcccttaat
aatctggccaacataaaacgtgaacaaggatatatcgaagaagcaactcgattatatctg
aaagcgcttgaagtattccctgagtttgccgcagctcatagcaatctggcttccgtatta
cagcaacaaggaaaattaaatgaagcactgatgcattacaaggaggctattcgtattcag
ccaactttcgcggatgcgtactcgaacatgggcaatactctgaaagaaatgcaagatata
caaggagctcttcaatgctatacaagagctattcaaattaatcccgctttcgctgacgcc
cattccaatttagcttcgattcataaggattctggaaacattcctgaggctattcaatca
taccgaactgcattaaagctgaagcctgacttccctgatgcatattgtaacttagcgcat
tgccttcagatcgtttgcgattggactgattatgaagctcgaatgaagaaattagtttcg
atcgttgctgaacaactggacaagaataggttgcctagcgtacatccacaccattccatg
ctctatccgttgtctcatgaatttagaaaggctattgctgctaggcatgcaaatctttgc
atcgagaagattcatgttctacataaacaaccatacaagtatccacgtgagattggtgct
cgcttaaagattggctatgtctcgtcagattttggaaatcatcctactagtcatcttatg
caatcaatcccaggactgcacgagagacagaatgttgaaatcttttgctacgctctcagc
gcagatgacggaaccacgttccgagcaaagattgccagagaagctgaacattttgtagat
ctatcacagattccgtgcaatggaaaagcagctgatcgtattaacgcggatggaattcat
attttagtaaatatgaatggatacacgaaaggagcgaggaatgaaatattcgctctgaga
ccagcacctgttcaagtgatgtggcttggatatccaggaacatcaggagctagtttcatg
gattatttaattacagatgaagttacatcaccattggaacttgctaatcaatacagcgaa
aaacttgcttacatgccacacacttattttattggagatcataagcaaatgttcccacat
ttaaaggaacgtctcatcttaacggacaaactgaatatgaagggcaaggtagcagataac
gtagctgtaataaatgccaccgatctttctccaatgattgaaaatacctgtgtaaaagaa
attcgcgaagtagttgtaccggatgctgaaaacaaaccagtagaaatttcgctcaaagtt
gcagaactgccaaccactactcctatcgaaacaatgattgcttctggacaatgccaaatg
tccgtaaatggtgtcgtagttcaaaatggtatggccactacgcaagtgaacaataaaaca
gctacgggtgaagaagtgcctcaaaatattatgatcacaacgaggcaacagtatggtcta
ccagaagatgcagtcgtttattgcaatttcaatcagttatataaaattgatccgctcacg
cttcatatgtgggcacatatcctaaaacacgtgccaaactctgtattatggctgctacgc
tttccggccgttggtgaaccaaacttacaagcaacagctcaacagttgggcttagccccc
ggtaggatcctgtttagtaatgttgctgcgaaggaagagcatgttagacgaggacagtta
gccgacgtatgcttggacacaccgctttgcaatggtcacactactagcatggatgtttta
tggaccggaactccggtggttacactaccaggtgaaacgttagcgtctcgcgttgctgct
agtcaattgaatactttgggatgccctgaattgattgcacgaacacgacaagaataccag
gatattgcaattcgtttgggtactgacagggaatacttgaaagcaacacgagccaaagta
tggaaagcaagatctgaaagtcctttattcaattgcaagctatatgcagtaggcatggaa
atgctgtacaaaaaaatgtgggaacgtttcgcgagaggcgaaaaacctgatcatgtgtca
gcagtagacaaaaccgaaatgcaaaaattactagcagctgcatcttaa

DBGET integrated database retrieval system