KEGG   Bombus terrestris (buff-tailed bumblebee): 100650486Help
Entry
100650486         CDS       T04364                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00052  Galactose metabolism
bter00500  Starch and sucrose metabolism
bter01100  Metabolic pathways
bter04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100650486
   00500 Starch and sucrose metabolism
    100650486
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100650486
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bter04147]
    100650486
Enzymes [BR:bter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100650486
Exosome [BR:bter04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100650486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 100650486
NCBI-ProteinID: XP_020720466
LinkDB All DBs
AA seq 994 aa AA seqDB search
MKKFIKTIEMNVKDIQQFVPKNKVLDRYSKYILTYNFLKLIIFIILLGVTIVFLQQSKCI
IIEEYEKDIISRNDEILQNTNYKLVNDSMILSKKENFEYDIESHDTISKFPRIVQKQCND
IPATLRFDCHPEDGASELSCRNRGCCWNSLNRKISTTRPVPLNLPYCYYPSDWSIYRYQN
YSKEGNNFFGFLKQIKSSFYENDLPLVKVETSTIDDSILRIKIYDPLKKRYEPPWPLRAD
PKPFLQKTXNAKYKLEIDNTKPGFKVYRTFDDTVIFDSINTAGFIFADQFLQISALLPSH
NIYGIGEHKTKLKLNTNWQMFTLLNKDQPPIENANLYGSHPFYFIIENSGRSHGLLFLNS
NAMDVILQPSPAITFRTIGGVFDIYFFLGPTPTDVIKQYSEIIGKPFLPPYWSLGFHLCR
YGYGTLEKTKEIWNRTIAAGIPFDTQWNDLDYMDKNNDFTYNPKTFKELPQFVNEIHSKG
MHYIPLIDAGISGSEKHGTYLPYDEGMKEDIFIKDGATDQPFVGKTWNFVSTVWPDFTNP
KTQNYYFHMMSNMHDSFAYDGAWIDMNEPSNFYDGHKNGCPKSKLDYPKYVPNVVGDILA
TKTLCMNAKHYLGLHYDLHNTYGTSQAIATNYALTNIRRKRPFIISRSTWVGHGHYAGHW
TGDIYSSWHDLKMSIPAILLMNFYQIPMVGADICGFNGNTTAALCNRWMQLGAFYPFSRN
HNSDDTIEQDPVAMGDLVIKSSKRALTIRYWLLPYLYTLLFRAHKFGETVARPLFFEYSN
DSATYDIDTQFLWGSSLMIIPVLEENKTEVSAYLPHGVWYNFYTKESVFALGKYYTMNAP
LDTIPLMIRGGSILPVQKPADTTTSSRKNNFELLITLDHVKKAKGELYWDDGDSLDSLEK
EQFVWSVFTIENDTLSTAKAMKSSFNEKMILGGIQIWGITSNISRVSLNNHEIQFKYDNK
EDCLNISNLQIDLRENFLLLWEYTDFEQHDDSNK
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttattaaaacaatagaaatgaatgtgaaagatatacaacaatttgtacca
aaaaataaagttttagatagatattccaaatatatattaacatataattttctgaaattg
atcatattcattattctgcttggtgtaacaatagtgtttttacaacaaagcaaatgcatt
attatagaagaatatgaaaaggatataatctctagaaatgatgaaattctacagaataca
aattataaactggttaatgattctatgatattatctaaaaaagaaaattttgaatatgat
atagaatctcatgacacaatatcgaaatttcctagaattgtacaaaaacagtgcaacgac
attcctgctacattacgctttgattgtcatcctgaagatggagcatccgaattatcctgt
agaaatagaggttgttgttggaattctcttaacagaaaaatatcaacgacaagacctgtt
cctttgaatcttccatattgttattatccaagtgattggagcatatacaggtatcaaaat
tatagtaaagaaggaaacaacttttttggattcctcaaacaaataaaaagctccttttat
gaaaatgacctaccactggttaaagtagaaaccagcactatagatgattctattctacgt
ataaaaatatatgatcctcttaagaaacgatatgaaccaccatggcctctcagagcagat
cccaaaccatttcttcaaaaaacgnttaatgcaaaatacaaattagagattgataatact
aaacctggttttaaagtatacagaaccttcgatgatacagtgatatttgactctattaat
acagcgggtttcatatttgctgatcagtttttgcagataagcgctcttttgccgagccat
aatatttatggtattggcgaacataaaacgaagctaaaattaaataccaattggcaaatg
tttacattattgaacaaagatcaaccaccaatagaaaatgcaaatttatatggatctcat
cccttctatttcataattgaaaattctggaaggtctcacggtcttctatttctcaatagt
aatgcaatggatgtgatattacaaccgtcgcctgctattacctttcgaactattggcggt
gtttttgatatatatttctttctgggtccaaccccgacagatgtcataaaacaatattct
gagataataggcaaaccatttctccccccatattggtcccttggttttcatttatgcaga
tacggatatggaaccttagaaaaaacaaaggaaatatggaatagaaccatagcagcggga
attccatttgatactcaatggaatgatttagattacatggataaaaataacgatttcaca
tataatccaaaaacatttaaggagttaccacaatttgtgaatgagatacattcgaaagga
atgcattatattcccttgatcgatgcgggaatatctggttctgaaaagcacggaacttat
ttgccatatgatgaaggtatgaaagaagatatatttataaaagatggagcaactgatcag
ccatttgttggcaagacgtggaattttgtttctactgtgtggcctgattttacgaatccc
aaaacgcaaaactattatttccacatgatgagcaacatgcatgatagttttgcatacgat
ggtgcttggatcgatatgaatgagccatctaatttttacgatggacataaaaatggatgt
ccaaaaagtaaattggattatccgaaatatgtaccgaacgttgtaggagacatacttgca
acaaaaacattgtgcatgaacgctaagcattatttaggtcttcattatgatcttcataat
acttatggcacaagtcaagcaatagcaacgaattatgcactgaccaatattcgacgaaaa
agaccatttataatatcacgttcaacttgggtgggtcatggacactatgctggtcattgg
acaggagatatttattcctcatggcacgatttaaaaatgagtattccagcaatattgttg
atgaatttttaccaaataccaatggttggtgctgacatttgtggatttaatggaaataca
acagcggcattatgtaatcgttggatgcaacttggtgcattttatcctttttctcgtaat
cataattccgacgatacaatcgaacaagatccagttgctatgggcgatttagtaataaaa
tcatcaaagcgagcccttacgatacgttactggttgttaccctatttatatacgttatta
tttcgagcacataaatttggagaaactgtagcgcgaccattattctttgaatactcgaac
gattcggccacatacgatatcgacactcagttcttatggggtagttctttgatgataatt
ccagttttagaagaaaacaaaacggaagtatcagcttatttaccacatggagtgtggtat
aatttttatacaaaagaatccgtcttcgcgctgggtaaatattacacgatgaatgcgcca
ctcgatactataccattgatgattcgcggaggatccattttaccagtacagaaaccagct
gatactacaactagcagtagaaagaataatttcgaattattgattactttggatcatgtg
aaaaaggcaaaaggcgaactatattgggatgatggcgatagtttagattcgctggagaag
gaacaatttgtatggtcagttttcaccattgagaatgatactttatccactgccaaagca
atgaagagttcttttaatgaaaaaatgatcttaggaggaatacaaatatggggaataaca
tctaatatttcacgagtatctttaaacaatcacgaaatacagtttaaatatgacaataaa
gaagattgtttgaacataagcaacttacaaatagacttaagagagaatttcttgcttctt
tgggaatacactgattttgaacaacatgatgatagtaacaaatga

DBGET integrated database retrieval system