KEGG   Bombus terrestris (buff-tailed bumblebee): 100650521Help
Entry
100650521         CDS       T04364                                 

Definition
(RefSeq) maltase A3
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00052  Galactose metabolism
bter00500  Starch and sucrose metabolism
bter01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100650521
   00500 Starch and sucrose metabolism
    100650521
Enzymes [BR:bter01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100650521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 100650521
NCBI-ProteinID: XP_020718665
LinkDB All DBs
AA seq 623 aa AA seqDB search
MHQFRGILLLVFGLLAVGSTSSQLLDKQWWETALVYQIWPRGFQDSDGDGEGDLQGITNR
LDYLQELGIDTIWLNPIYSSPLKDSGYDISDYTEINPLFGNLQVFDEFIQQAHKRDLKVI
LDIVPNHSSDQHKWFLQSSQNNKQYSDYYIWANGSKDQNGNKIPPNNWISTYNDKEGSAW
TWHDTRQQWYYHKFHKSQPDLNLRNKNVIQELLDVFNFWLKRKVDGFRIGAVSYLYEDKD
LKDEPVVGNGTYTSGLPESIDLVYKFRSYIDNWVKENNAPSKLLIAESYDSDEMLISLYG
NATHNGIPPFNFRFITSVQNTSTAEHIKNVLEDWFKKLPNKADTNWVLSNHDTSRAASRI
GLNRVDGLHMLSLLLPGQAYTYYGEEIGMLDRKMSWNETIDPMGCSRSKEIFGNYSRDPA
RTPMQWDSSTSAGFSLNKITYLPVHPDYTERNVKAQLKSSQSNLKTYKSLATLRKDKVFT
HGDYEFATLNNDRVFVFKRSLANNPTYIVVINLGLRQETVNLTSVYPNLKDPVEIIIASS
NAVNITSNISAQNVILTANAAFVLKAEDICNCESSTEPGGSDTTPSTPECTTEKNSALIS
SSVTWLIGSISITVVLLNILTFH
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattccgtggaattctactgttggttttcgggctgctggccgtgggatcgaca
agctcccagttgctggacaaacaatggtgggaaaccgctttggtctatcaaatctggccg
agaggatttcaggatagcgatggagatggcgagggtgacttgcagggtataaccaaccgg
ctggattatttacaagagcttggaatcgacacaatttggctaaatcctatctactcatca
ccactgaaagattctggatacgatatttctgattataccgagataaatccactgtttggt
aatctccaggtctttgatgagttcatacaacaagcacataaacgtgacctaaaggtcatt
ttggacatagtaccaaatcattcaagcgatcaacataaatggtttctgcaatcaagtcaa
aataataagcaatacagtgattactacatttgggcaaacggttccaaagatcaaaatggc
aacaagataccacctaataactggataagcacctacaatgacaaagagggatcagcatgg
acatggcacgatacaaggcagcaatggtattatcataaatttcacaaatctcaacctgac
ctcaatttgagaaataaaaatgtgatacaagaattattggatgtgttcaacttttggctg
aaaagaaaagttgatggttttcgaattggtgcagtgtcgtatctttatgaagataaggat
ttaaaagacgagcctgttgtagggaatggaacctatacatctggtctgccagagagcata
gatcttgtatacaagtttcgttcatatattgataattgggtaaaagagaataatgctcct
tcaaaattattaattgcagagtcttatgactctgatgaaatgttgatatcgctttatggt
aatgctacgcacaatggaattccaccctttaatttccggtttattacttctgttcagaat
acaagcactgctgaacacattaaaaatgttctggaagactggtttaagaaacttccaaat
aaagcagacacaaattgggtgctttccaatcatgatacttcaagagcagcctcaagaatt
ggattgaatcgtgttgatggacttcatatgcttagtctattgttacctggtcaagcatat
acttactatggagaagaaattggaatgctagacaggaagatgtcatggaatgaaacaatc
gaccctatgggttgttcgaggtcaaaggaaatatttggaaactattccagagatcctgca
agaacaccaatgcaatgggactctagtacatcagcaggattttcacttaataaaattaca
tatcttcctgttcatccagattatacagaaagaaacgtcaaagcacagctaaaaagttca
cagagcaatttgaagacatataaatcacttgctactcttagaaaagataaagtattcact
catggagattatgaatttgcaaccttaaacaatgaccgcgtgtttgtctttaaaagatct
ttagcaaataatcctacatatatcgttgttattaacttgggtctacgacaagaaacagtt
aatctaacgtcggtgtatccgaacttaaaagatccggtagaaattattatcgcatccagt
aatgcagttaacattacgtcaaatatttcggcacaaaatgttatactcacggcaaatgca
gcatttgtcctgaaagctgaggatatatgcaattgtgaatcatctacagaacccggagga
tctgataccactccttcgactcctgaatgcacaacagagaaaaattctgcccttatttcc
tcctcagtaacatggttaataggaagtataagcatcacagtagtgttattgaatatttta
acgtttcattga

DBGET integrated database retrieval system