KEGG   Bombus terrestris (buff-tailed bumblebee): 100650808Help
Entry
100650808         CDS       T04364                                 

Definition
(RefSeq) annulin isoform X2
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100650808
Enzymes [BR:bter01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100650808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 100650808
NCBI-ProteinID: XP_003395643
LinkDB All DBs
AA seq 755 aa AA seqDB search
MGKFCSCFSRFRAIFRPETVTDGPLKPLCTKPECLPRPPAASSSGEDFGVPVLTIADVDP
CIAENGVNHRTSRYDLMTRQDDKSRLVVRRGQEFYLHLTLSRDYEPSIDGMSIIFTVDGV
ERPLYGHGTLVATAVLYPGEPSEGSWHATIDAIQHNFIRLKIVAAPDAIIGKWRIDIDTK
NKNLDGAVSYTVKQPFYLIFNPWCAEDAVYMEEEDQRQEYVMAEDGLIWRGSYNRLRPTV
WKYSQFERDILDCALHLMIQVGKVRIHGRNDPVVISRILSAAVNSPDDNGAVMGNWSDDF
GGGTPPTKWLGSQKILQQYYKTKKPVKYGQCWVFSGVLATVCRTLGLPCRVVTNYASAHD
TQSSLTVDYFVDAEGKIMEEMNSDSIWNFHVWNEVWMTRMDLSPEYSGWQAIDATPQELS
EDAYRCGPASVAAVKKGEVLRPYDNAFLFAEVNADKVFWRYNGPTQPLKLIRKDVYGIGQ
FISTKAIGRWAREDITHTYKYPEKSEEERAAMLKALRQSQSLFSRYYLNEEFNEVMFNFE
LRDDIVIGQPFSVVLLIKNRSNYNEYEVSVILRVETVLYTGRVGDPVKRLNIDRLVRPGV
LEEVRMDVSWEEYGPRLLNQCAFNISCLATIKDTNFEYFAQDDFRVRKPDIKITLENEPE
VGKTLNATAKFQNPLPIPLKKCRFLIEGPGMDEQLKLKLSDQVEVDAYAECSFSMVPKFE
GRATIAAKFYSKELEDVDGFVNFMVKSMKAVTNGE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagttttgttcttgtttttcacgatttagagcaatttttagacccgaaactgtt
acggacggtccccttaagccattatgcacaaaaccggaatgtcttccacggccacctgct
gcatctagttctggggaagattttggagttccagtgttgacgatcgcagatgtggatccg
tgtatcgcggagaatggagtcaatcacagaacatccagatacgacttgatgactagacag
gacgacaaatctaggctggtcgttagacggggacaagaattttacttacacttgactttg
tccagagattacgagccaagtatcgatggtatgtcgataattttcacggttgacggagtt
gagaggccgctatacgggcacggaaccctcgttgcgacggctgttctttatccgggagaa
ccgtccgagggttcctggcatgccaccattgacgctattcaacacaattttattcgattg
aagattgttgcagctcccgacgcgataataggcaagtggaggatagacatcgacaccaag
aacaagaatttagacggagccgttagttacacggtgaaacaaccgttttatctaattttc
aatccctggtgcgcagaggacgcggtgtacatggaggaggaagatcagcggcaggagtac
gtgatggcggaggatggtttgatatggcgtggaagctacaatcgtctgagaccaacggtt
tggaaatattcgcaattcgagcgagacatattagattgcgcgctgcatctgatgattcaa
gttggcaaagttcgaatacacggcagaaacgatcctgtcgttatatctcgcattctgtcg
gcagctgtaaattcgccggatgacaatggcgcggtaatgggtaactggtccgatgatttt
ggaggtggcacaccaccgaccaaatggttgggttcgcaaaagatcctgcaacaatactat
aagacgaagaaaccggtcaagtatggtcaatgctgggtattctcaggagtgttggccacc
gtttgccgtaccctgggactaccttgtcgcgtggtaaccaattatgcgagcgcgcacgac
actcagagcagcttgaccgtcgactatttcgtcgatgccgaggggaaaattatggaggag
atgaacagcgattcgatatggaatttccacgtgtggaacgaggtatggatgactagaatg
gacttgtcgccggaatattctggttggcaagcgatcgatgcgactcctcaagaattgagc
gaagacgcgtaccgttgcggaccggcttccgtcgccgctgtgaagaaaggcgaggttctc
cgaccttacgacaatgccttcctgttcgccgaggtcaacgcggataaagtgttttggcgt
tacaatggaccgacccaacctttaaagttgattcgaaaggacgtgtacggcatcgggcaa
tttattagcacgaaagcgatcggtagatgggcgagggaagatatcactcatacctacaag
tatccagaaaagtcggaagaagaacgggctgccatgttgaaggcgttgcgtcaaagtcag
tcgttgtttagtcgttattacctcaacgaggagttcaacgaagtcatgtttaacttcgag
ttacgcgacgatatcgtgatcggacaacctttcagtgtcgtgttgctgattaaaaataga
agcaattacaacgagtatgaggtctcggtgattttaagagtagagacggttctgtacacc
ggacgggtcggcgacccagtgaagagattaaatatcgatcgactggtgagacctggagtc
ctcgaggaagtgcgtatggatgtatcctgggaggaatacggacctcgattattgaatcag
tgcgcattcaatatttcctgcctggcgaccatcaaggacaccaatttcgagtactttgcg
caagacgactttcgcgtgaggaaacccgacattaaaatcacgttggagaacgagccggaa
gttggcaagacgttaaacgcgacagcgaaatttcaaaatccgctacccatcccattgaag
aagtgtagattcttgatcgaggggcctggaatggacgagcagctgaaattgaaactgtcg
gatcaggtagaggtggacgcgtacgcggaatgttcgttctctatggtaccgaaattcgaa
ggccgtgccacgatcgctgcgaaattttactcgaaagagctcgaggacgttgacggtttc
gtcaattttatggtaaaatcgatgaaagccgttacaaacggcgagtaa

DBGET integrated database retrieval system