KEGG   Bombus terrestris (buff-tailed bumblebee): 100651312
Entry
100651312         CDS       T04364                                 

Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Brite
KEGG Orthology (KO) [BR:bter00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bter04052]
    100651312
   00536 Glycosaminoglycan binding proteins [BR:bter00536]
    100651312
Cytokines and growth factors [BR:bter04052]
 Growth factors
  Growth factors (RTK binding)
   100651312
Glycosaminoglycan binding proteins [BR:bter00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100651312
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 100651312
NCBI-ProteinID: XP_003393407
LinkDB
AA seq 231 aa
MSLRWIHENLEAPTCDEECSDIDDSCSDDSYDSDLSICEEKGPGNEKEINGDRRRKRETR
RHPTTTVKFDENGTPHYITESVKRPPYVIWDPRKPAQNPVYNCLVIKLFCRTGYHLAVSN
SGRVRGLSATNEPHALLHIIPVSFGVIRIQSLETSLYLAFNKKGRLYGELSANKDNTEWE
QWNVGSYDAFRSRKYANQGWWIGIKKNGRAKPGPKTSWGQKSIQFLAIRQD
NT seq 696 nt   +upstreamnt  +downstreamnt
atgagtcttcgttggattcacgaaaacttagaagcaccaacatgcgatgaggaatgcagc
gacatcgatgacagttgcagcgacgacagctacgattccgatctatcaatctgcgaggag
aaagggcctggaaacgaaaaggagatcaatggggatcgcaggaggaaaagggagaccagg
agacatccgaccactacagtgaagttcgacgagaacggaactccgcattacatcacggaa
tcggttaaacgaccgccttacgtaatatgggatcccaggaaaccggcacaaaatcctgtg
tacaattgtttggtaatcaaattgttctgtcgaaccggataccatcttgctgtttcgaac
tctggtcgagttcgaggtttgagtgccacgaacgagccacatgctttgcttcacattata
ccggtatcatttggagtgattcgaatacaaagtcttgaaactagtctgtatttggctttc
aataagaagggacgtttatatggtgagctaagcgcaaacaaagataacacagaatgggag
caatggaacgtcggttcctacgatgcttttcgatcacgaaaatacgcgaatcagggatgg
tggataggaataaagaaaaatggacgagcaaagccaggaccaaaaacaagttggggccaa
aaatcgatacaattcctagcaatacgacaagattaa

DBGET integrated database retrieval system