KEGG   Bombus terrestris (buff-tailed bumblebee): 100651573
Entry
100651573         CDS       T04364                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter00230  Purine metabolism
bter01100  Metabolic pathways
bter04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:bter00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100651573
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100651573
Enzymes [BR:bter01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100651573
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF2258
Other DBs
NCBI-GeneID: 100651573
NCBI-ProteinID: XP_003398726
LinkDB
AA seq 994 aa
MLRSQETSNEDSYLSSGRPSNLLRTSFSSAKLETLYRASSLQQRRGGLEYFLFSALLYAA
HSLITPGQELSTRSLTAVFLGLNLGLLAWAKHNPRAKDALWSVIPHVAWNLSTAQLLTQL
FLKSTEVTPRDGLGWLLLMLYLLFATLPLRLPLCVLLAISTALVYIISVVGLSKAPAQIP
IDVLVLTVTLSIGAMLLGASSYSLTEFQQRRAFLETRQSLEVQLVIEEQSAEQERLLLSV
LPEHVAVMMRQDLGASLDTQFKKIYMSRHENVSILYADIVGFTAISSTYSASELVKILNE
LFARFDQLSERYEQLRIKILGDCYYCISGAPVERPDHAVLCVYMGLSMVDAIKYVQQKTN
SPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKDVELANKMESSGMAGRVHISNTTLSFLNG
EFEVEPAHGEDREEALQKAGIVTYFIVRALKPFKPAATKSIASLTEDARKTIDAGNERNN
NKEDSEEFRQRLRKELDNKTGGAHLKGHAYWLTLRFKDSKVESEFHHAEEAFSPLSLLGG
PLVMICAAPVWRFQPWGPFTWGGIGIVVLFAVVLAGATCLGSAIKAMWLRRALALMMTFS
LGIFLILDMFNCVVIEETIPPLNATITLSSRCPYPSYYSYIGVLTLVATSMPTYICYLGK
AYLMYGISGVQCFINICLLNARLDWEDYASSLEPTPLPSKYCLSATLLIVATSLVIVSRY
AEKSRRMLYLRGREVVAQRERAADMTRRNGALIYNILPPHVAAYFLSSARHHDDLYSQSY
AEVGVLFASMPNFADFYSEESINNQGLECLRFLNEVISDFDAILDQSKFKDIIKIKTIGS
TYMAASGITDSEESEDAPRWGHLSTLVEFALELKKALSSINEQSFNHFVLKMGINHGPVT
AGVIGARKPHYDIWGNTVNVASRMESTGKVGCIQVTDETRRILEPFGFGFEQRGLVFVKG
KGQLLTHYLISKDGVSLNLDSDLPVEPTHPIIYQ
NT seq 2985 nt   +upstreamnt  +downstreamnt
atgttacgaagtcaagagacctcgaacgaggattcctacctgagctcgggcaggccgtcg
aacctgctgcggacgagcttcagcagcgccaagttagagacgctatatcgcgcctcctcc
cttcaacagagacggggtggcctcgagtactttctgttttcggcgcttctctacgcagct
cactcgttgatcacgcctggtcaggagctatcgactcgaagcttaaccgccgtcttcttg
gggttgaatctgggcctgctggcctgggctaaacacaatcccagagcgaaagatgcgctt
tggtcggtgataccacacgtggcctggaacctgtcgaccgcacagctacttactcagctg
ttcctcaagtccaccgaggtcacgcctagggacggactaggctggctgttgctcatgctc
tacctgctgttcgccactttacccctcagactgcccctctgcgtcctccttgccattagc
accgcattggtgtacatcatctccgtcgttggactctccaaagcacctgcacagataccc
atcgatgttttggtgctgacagtgacgctatccataggcgccatgcttctgggtgcttcc
agttactctctgaccgagtttcaacaacgtagagcctttttagaaaccagacagagcctg
gaagtgcaacttgtgatcgaggaacaaagcgccgagcaggaaaggctgctgcttagcgtg
cttccggaacacgtggctgtaatgatgcgacaggacctaggcgcctcgctggatacgcag
ttcaagaaaatttacatgtccaggcatgagaatgtctcgattctctatgcggacattgtt
ggatttactgcgatttcttccacgtacagcgctagcgaactagtgaagattcttaacgag
ctatttgctagattcgatcaactcagtgaaagatacgagcagctgcgaataaagatcctc
ggcgactgttactactgcataagtggagcacccgtggaaagaccagaccacgctgttctc
tgcgtctatatgggcttatctatggtggacgccatcaagtacgtgcaacaaaagaccaat
agccctgtcgacatgagggtgggcatacacactggtgctgtgttggccggtgtcctcggg
cagagacaatggcaattcgatgtgtacagcaaggatgtcgaactcgcgaacaagatggag
agcagtggaatggcagggagggtgcacatctcgaacacgacgctgagcttcctgaatggc
gagttcgaggtcgagccagcgcacggcgaggacagagaagaggcactacagaaagcgggc
atcgtcacatacttcatagtccgggcgttgaaacccttcaagccagctgccaccaagagc
atcgcctcgctcacggaggacgccaggaagacgattgacgcaggaaacgaaagaaataac
aataaagaggactcggaggaatttagacagaggctgaggaaggaactggataacaagact
ggcggagcacatttgaaaggtcacgcgtactggttgaccttgcggttcaaggactcgaag
gtggagtctgagtttcaccacgccgaagaagcattttcccctttgtcattgctcggtggg
ccattggtgatgatctgcgccgccccagtttggaggtttcagccctggggaccttttaca
tggggcggtattgggatagtggtgctattcgcggtagttttggctggtgccacgtgtctg
ggcagtgccatcaaggctatgtggctgagaagagctctggcccttatgatgacattttcc
cttggcatttttctgattctcgatatgttcaattgcgtggtcatcgaggaaaccattccg
cccctaaacgccaccataaccctgtcttcgaggtgtccatatccttcatactactcgtac
atcggtgtgcttacacttgtggcgacctcgatgccgacctacatatgctatctaggcaag
gcgtacttaatgtacggcatctcgggcgtccagtgtttcatcaacatctgtctactcaat
gcgaggctggactgggaggattacgcttcttccctcgaaccgaccccccttccatcgaaa
tattgcctatctgccactcttctcatcgtagctacttctctggtcatcgtgtccagatat
gcggaaaagtcgaggaggatgttgtacctacgaggaagggaggtggtggcgcaaagagaa
agggcggcggacatgacgcgcagaaacggcgccctcatctacaacatccttccgccgcac
gtggctgcttattttctatcgagtgcgagacaccacgatgatctctacagccaaagctac
gccgaagtgggtgttctgttcgctagtatgccgaactttgccgatttctacagcgaagag
agcatcaataatcagggcctcgagtgtctcaggttcttgaacgaagtcatatccgatttc
gatgcgatcctcgatcaatctaaattcaaggacatcatcaagatcaagacgataggctcg
acatacatggcggcatccggaatcacagactcggaggagtccgaggatgctccccggtgg
ggtcacttgtccactctcgttgaattcgccctggagttgaagaaagcattgtcgagcatc
aacgagcaaagcttcaatcactttgttctgaaaatgggtatcaatcacggccctgtgact
gctggggttattggcgccaggaaacctcattacgatatctggggaaataccgtgaacgtg
gcgtctagaatggaaagcactggaaaagtaggctgcatccaggtcacagacgagacccgg
aggattctggagccatttggcttcggcttcgaacaacgcggcctggtgttcgtcaagggc
aaaggtcagctgctcacccattacctgatatccaaggacggcgtgtccttgaatttggac
agtgacctgccggtcgaacccacccatccgatcatctatcagtag

DBGET integrated database retrieval system