KEGG   Bombus terrestris (buff-tailed bumblebee): 100651623
Entry
100651623         CDS       T04364                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen isoform X1
  KO
K16679  wengen
Organism
bter  Bombus terrestris (buff-tailed bumblebee)
Pathway
bter04013  MAPK signaling pathway - fly
bter04214  Apoptosis - fly
bter04215  Apoptosis - multiple species
bter04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:bter00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100651623
   04391 Hippo signaling pathway - fly
    100651623
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100651623
   04215 Apoptosis - multiple species
    100651623
SSDB
Motif
Pfam: TNFR_c6 Trp_oprn_chp CD225 HCO3_cotransp
Other DBs
NCBI-GeneID: 100651623
NCBI-ProteinID: XP_003401944
UniProt: A0A6P3DMH3
LinkDB
AA seq 294 aa
MPREPNRAYLLAVLLLLVGLRKAGCSTSAPRYPVCKPGFEFWSVERATCWPCTRCAPEFT
LSPCAVYKDAICGPLSALELDWSFLSTRKRPETGQRSLEAVTSKVLWRFPDLDQQQIRQE
SKDFADNSQPDIQSKTKDQVSNESSYPRSAATSKERILWDWQTVALILAVCACILFFLVA
GCSALVYARQWRRMKKNFEPVGLEEISARLNLMVKAELAELVAGAPMNPGDPETRCQYLE
KLLDRKRETPVVSDWPEVSGNVYIEDGDPSKKLQIARIHRNIETMLNQKKSFSD
NT seq 885 nt   +upstreamnt  +downstreamnt
atgcctcgggagcctaatcgggcatatctgttggccgtgttgctgctattggtcggtctc
cgcaaggctggctgctcgacatccgctccccgatatccggtctgtaaaccgggtttcgaa
ttttggtcggtcgagcgtgccacctgttggccttgcaccagatgcgctcctgaattcact
ttgagtccctgcgccgtttacaaggatgctatttgcggaccgctctccgctctcgagctc
gactggtctttcctctcgaccaggaaacgaccggaaaccggccaaaggagcctcgaagcg
gttacctcgaaggtgttatggaggttccccgacctggaccagcaacagattaggcaagag
tcgaaggatttcgctgacaattcgcagccagatatccaatcgaaaacgaaggaccaggta
tcgaacgagtcttcttatccaaggagcgcagctacttccaaggagagaatcctgtgggac
tggcaaacggtcgcgctgatccttgcggtgtgtgcctgtattctcttttttctggtcgca
ggatgctcggctttggtctacgcgagacagtggcgtcggatgaagaaaaacttcgagccc
gtgggtctagaagagatctcggctcgattaaatttaatggtcaaggcggaactagccgaa
ctggttgccggcgcaccaatgaaccctggtgatcccgaaacaaggtgccagtatctcgag
aaactcttagatcgaaaaagggagactcctgtggtgtccgattggccggaagtcagcggg
aacgtttacatagaagacggagatccttcgaagaaattacaaatcgctagaattcatcgg
aatatcgagacgatgttaaatcagaagaaaagtttcagcgattga

DBGET integrated database retrieval system