KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_03270Help
Entry
YBT020_03270      CDS       T01839                                 

Definition
(GenBank) bacillolysin (thermolysin-like metalloprotease, peptidase M4)
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Brite
KEGG Orthology (KO) [BR:btf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:btf01002]
    YBT020_03270
Enzymes [BR:btf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     YBT020_03270
Peptidases [BR:btf01002]
 Metallo Peptidases
  Family M4: thermolysin family
   YBT020_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ADY19901
UniProt: F0PYG6
LinkDB All DBs
Position
695979..697679
Genome map
AA seq 566 aa AA seqDB search
MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSPEFVSGDLTEATGKKA
ESVVFDYLNAAKGDYKLGEKSAQDSFKVKQAKKDAVTDSTVLRLQQVYEGVPVWGSTQVA
HVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQKDLGITPKYEVEPKADLYV
YQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNKLDHVANEDKSPVKQEAPK
QEVKPAVKPVTGTNAVGTGKGVLGDTKSLNTTLSSSSYYLQDNTRGATIFTYDAKNRTTL
PGTLWVDADNVFNAAYDAAAVDAHYYAGKTYDYYKATFNRNSINDAGAPLKSTVHYGSKY
NNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVTEYSSDLIYQNESGALNEAISD
VFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDPTKYGDPDHYSKRYTGTSDNGGV
HTNSGIINKQAYLLANGGTHYGVTVTGIGKDKLGAIYYRANTQYFTQSTTFSQARAGAVQ
AAADLYGANSAEVNAVKQSFSAVGIN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaagtttagcgttagtgttagcgacaggaatggcagttacaacatttgga
gggacaggctctgcatttgcggattctaaaaatgtgctctctacgaagaagtacaatgag
acagtacagtcacctgagtttgtttctggggatttaactgaagcaactggtaagaaagca
gaatctgttgtgtttgattacttaaatgcagcaaaaggtgattataagttaggggaaaag
agtgcgcaagattctttcaaggtgaaacaagcgaagaaagatgctgtaactgattcaaca
gtattacgtttgcaacaagtatacgaaggagtacctgtatgggggtctacgcaagtagct
catgtaagtaaagatggttctttaaaagtattgtctggaacagttgcgcctgatttagac
aaaaaagaaaaattgaaaaataaaaataagatcgaaggcgcaaaagcaattgaaattgcg
caaaaagatttagggattacacctaaatatgaggtagaaccaaaagcggacttatatgta
tatcaaaacggtgaggaaacaacatatgcatacgttgtaaatttaaacttcttagaccca
agtccaggaaactactactatttcattgaagcagacagcggtaaagtgttaaataaatat
aataaacttgatcatgtagcaaatgaagataagtcaccagttaagcaagaggcacctaaa
caggaagtgaaaccagctgtaaagcctgtaacaggaacaaatgcagtgggtactggtaaa
ggtgtattaggagatacgaagtcgcttaatacaacgttatctagctcatcttactactta
caagataatacgcgcggagcaacgattttcacatatgatgcgaaaaatcgtactacattg
ccaggaactttatgggtagatgcagataatgttttcaatgcagcgtatgatgcagcagcg
gtagatgctcattactatgcaggtaaaacatatgattactataaagctacttttaataga
aattctattaatgatgcaggagcaccattaaaatcaacagttcattacggaagtaagtat
aacaatgcattctggaacggatcacaaatggtatacggagatggtgatggtgtaacattc
acttcattgtctggtggaattgatgtaatcggacatgaattaacgcatgctgttacagag
tatagctcagatttaatttatcaaaatgaatcaggagcattaaatgaagctatttcagat
gtttttggtactttagtagaattctatgataaccgtaacccagattgggaaattggtgaa
gatatttatacgcctggtaaagcaggagatgcacttcgctctatgagtgatccaacgaaa
tatggtgatccagatcattattctaagcgttacactggtactagtgataacggtggggtt
catacaaacagtggtatcattaacaaacaagcttatttattagcaaatggcggtacgcat
tacggtgtaactgtaactggtattggtaaagataagctaggtgcaatctattaccgtgca
aacacacaatatttcacgcaatctactacatttagtcaagcacgtgctggtgcagtacaa
gctgcagctgatttatatggtgcgaactctgctgaagtaaatgcagttaagcaatcattt
agtgctgttggtattaactaa

DBGET integrated database retrieval system