KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10780Help
Entry
YBT020_10780      CDS       T01839                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00473  D-Alanine metabolism
btf01100  Metabolic pathways
btf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YBT020_10780
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    YBT020_10780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btf01011]
    YBT020_10780
Enzymes [BR:btf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     YBT020_10780
Peptidoglycan biosynthesis and degradation proteins [BR:btf01011]
 Precursor biosynthesis
  Racemase
   YBT020_10780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Urease_linker DUF4170
Motif
Other DBs
NCBI-ProteinID: ADY21402
UniProt: F0PLI2
LinkDB All DBs
Position
2128717..2129943
Genome map
AA seq 408 aa AA seqDB search
MKREVEWNAIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKAAIEAGINQLAVAFVDEAIELREAGINVPILILGYTSVAAAEDAIQYDV
MMTVYRSEDLQGINEIANRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVV
GMFTHYSTADEIDKSYTNMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMV
RVGIGIYGMYPSKEVDHSVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQG
EENIAVEEIADMLGTINYEVTCMLDRRIPRVYKENNETAAIVNILRKN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaagtagaatggaatgcaattattgagttaggagttagaccaatgagtttg
aaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacataatgtaaaa
gaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgtaaaagcaaat
gggtatggccacggagcagttgaagttgcgaaagctgctattgaagctggaataaaccag
cttgcagttgcatttgtagatgaagcgatagagttaagagaagcaggaattaacgtgccg
attttaattttaggctatacgtcagtagcagctgcggaagatgcaattcagtatgacgtt
atgatgactgtttatagaagtgaagatttacaaggtataaatgaaattgcaaaccgtctt
caaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcattggtttacaa
gaagaagaggttaaaccatttttagaagaattaaaacgtatggagtatgtagaggtagta
ggaatgtttacacattactctacggcagatgaaatcgataaatcatatacgaatatgcaa
acaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcatattccatat
attcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaaaatatggtt
cgtgtcggtatcggaatttatggaatgtatccttcaaaagaggtagatcattcagttgtt
tctctgcagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcatgcgaagaaa
aatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatggattgccact
gtaccgattggttatgctgatggctataatcgtcagttatctaataaagggcatgcatta
ataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctcatgttagac
gtttccaaagcaatgccagtgcaagtaggagacgaagtagtattctacggtaaacaaggt
gaagagaacatcgcagtagaagaaatagcggatatgttaggtacaattaactatgaagtt
acatgtatgttagacagaagaatcccgcgagtgtataaagaaaataatgaaacggctgct
attgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system