KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_14150Help
Entry
YBT020_14150      CDS       T01839                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00010  Glycolysis / Gluconeogenesis
btf00053  Ascorbate and aldarate metabolism
btf00071  Fatty acid degradation
btf00280  Valine, leucine and isoleucine degradation
btf00310  Lysine degradation
btf00330  Arginine and proline metabolism
btf00340  Histidine metabolism
btf00380  Tryptophan metabolism
btf00410  beta-Alanine metabolism
btf00561  Glycerolipid metabolism
btf00620  Pyruvate metabolism
btf00625  Chloroalkane and chloroalkene degradation
btf01100  Metabolic pathways
btf01110  Biosynthesis of secondary metabolites
btf01120  Microbial metabolism in diverse environments
btf01130  Biosynthesis of antibiotics
Module
btf_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YBT020_14150
   00053 Ascorbate and aldarate metabolism
    YBT020_14150
   00620 Pyruvate metabolism
    YBT020_14150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YBT020_14150
   00561 Glycerolipid metabolism
    YBT020_14150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YBT020_14150
   00310 Lysine degradation
    YBT020_14150
   00330 Arginine and proline metabolism
    YBT020_14150
   00340 Histidine metabolism
    YBT020_14150
   00380 Tryptophan metabolism
    YBT020_14150
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YBT020_14150
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YBT020_14150
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YBT020_14150
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     YBT020_14150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADY22062
UniProt: F0PUS8
LinkDB All DBs
Position
complement(2757192..2758676)
Genome map
AA seq 494 aa AA seqDB search
MLTKNIELKPKVKAFLNEEIKMFINGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDID
VAVKAARSAFESGPWVEMTTAERAHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDD
IAATVENYRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGA
ALATGCTIVLKPAEQTPLSLLYAAKLFKEAGFPDGVVNFVPGFGPEAGAAIVNHHDIDKV
AFTGSTVTGKYIMRQSAETIKHVTLELGGKSPNIILEDADLEEAINGAFQGIMYNHGQNC
SAGSRVFVHRKHYETVVNELVKMANNVKLGAGMEKDTEMGPLVSKKQQERVLHYIEQGKA
EGATIAAGGERAFEKGYFVQPTVFIDVTDDMTIVKEEIFGPVVVVLPFDSTEEVIERANR
SSYGLAAGVWTQNIKTGHQVANKLKAGTVWINDYNLENAAAPFGGFKQSGIGRELGSYAL
DNYTEVKSVWVNIK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgaaaaacattgaactaaaaccaaaagtgaaagcgtttttaaatgaagaaatt
aaaatgtttattaatggtgaatttgttccttccattagtggaaagacgtttgaaacatat
aatccagcgacagaagatgttcttgcagttgtttatgaagcacaagaagaggatattgat
gtggcagtaaaagcggcacgatctgcatttgaatcaggaccttgggtagaaatgactact
gctgaaagagcacatcttatttataaattagcagacttaattgaagagcatggagaagaa
ttagcacagctagaagctttagataatggaaaaccatatcaagtagcacttgatgatgat
attgcagcgactgtagaaaattatcgctattatgcaggatgggctacaaaaattatcggg
caaaccattccgatttcaaaagattacttaaattacacacgccatgaacctgttggcgtt
gtaggtcaaattattccttggaattttccgctcgttatgtcttcttggaaaatgggagct
gcactagcaacaggttgtacgatcgtattaaaaccagcagagcaaactcctttatcctta
ttatatgcagcgaaactttttaaagaagcaggttttccagatggtgttgtaaactttgtg
ccaggtttcggccctgaagcgggagctgcaattgtaaaccatcatgatattgataaggta
gccttcacaggttcaacagttacaggaaaatatattatgcgtcaatctgcagaaacaatt
aaacatgtaacgttagaacttggtggtaaatcaccaaatatcattttagaagatgctgat
ttagaagaagcgattaacggtgcattccaaggtattatgtataatcacggccaaaattgt
agtgctggatctcgcgtgttcgttcaccgaaaacattacgaaacagtcgtaaatgaacta
gtaaaaatggcgaataacgtgaaacttggagcaggtatggagaaggacacggaaatgggt
ccactcgtatctaaaaagcaacaagagcgtgtgctacattacattgaacaaggaaaagct
gaaggcgctactattgctgctggtggtgaacgtgcatttgaaaaaggttattttgtacag
ccaacagtattcatagatgttactgacgatatgacgatagttaaggaagaaatcttcggt
ccagttgtcgttgtacttccatttgattcaacggaagaagtaatcgaaagagcaaatcgc
tcttcttacggactcgctgcaggcgtatggacacaaaatattaaaacaggacatcaagtt
gccaataagttaaaggcaggaacagtatggattaatgattataacttagaaaatgcagcg
gcaccatttggtgggtttaaacaatctggtatcggccgtgagttaggttcatatgcgctt
gataattacacagaagtgaaaagtgtttgggtaaatataaagtaa

DBGET integrated database retrieval system