KEGG   Bacillus thuringiensis Bt407: BTB_c02670Help
Entry
BTB_c02670        CDS       T02277                                 

Gene name
alr1
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00473  D-Alanine metabolism
btg01100  Metabolic pathways
btg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTB_c02670 (alr1)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BTB_c02670 (alr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btg01011]
    BTB_c02670 (alr1)
Enzymes [BR:btg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BTB_c02670 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:btg01011]
 Precursor biosynthesis
  Racemase
   BTB_c02670 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFV16036
LinkDB All DBs
Position
237358..238527
Genome map
AA seq 389 aa AA seqDB search
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKANAYGHDYVPVAKTALEAG
ATRLAVAFLDEALVLRRAGITVPILVLGPSPPRDVNVAAENDVALTVFQKEWVDEAIKLW
DGSSVMKFHINFDSGMGRIGIRERKELKAFLKSLEGAPFLELEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFELEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGF
EVLINGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IIATISFRVPRIFIRNGKVVEIINYLNNI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcaccattttaccgtgacacttgggtggaagtggatttagatgccatttat
aacaacgttacgcatattaaagagttcatcccaagtgatgtagagatttttgctgtagtt
aaagcaaatgcatatgggcacgattatgtaccggtggctaaaacggcattagaagcgggt
gcaacaaggttagcagttgcttttttagatgaagctttagtgcttcggagggctggtatt
actgtgccgattttagtgttaggtccctcgccgccgcgtgatgtaaatgtagctgctgaa
aatgatgtagcgctaactgtttttcaaaaagaatgggtggacgaagcaattaaactttgg
gatggttcatctgtaatgaaattccatattaactttgatagtggtatggggagaattgga
atacgtgaaagaaaagaactgaaagcatttttaaagagtttagaaggtgcaccgttttta
gagttagaaggagtatacacgcattttgcaacggcagatgaggttgagacttcgtatttt
gataagcaatataatacgttcttagagcagttaagttggttgaaagaattcggagtggat
cctaagtttgtccatacagctaatagtgctgccacgttacgttttcaagggattacattt
aatgcagtgcgaattgggattgcaatgtatggattatctccttctgtagaaatacgtcct
tttttaccatttgaattagaaccggcgctatcactgcatacgaaagtagctcatattaaa
caggtgattaaaggtgatggaattagttataacgtcacttatcgaacgaaaactgaagaa
tggatcgcgactgtagcgattggttatgcagatggatggcttagaagattacaaggattt
gaagtgcttataaatggtaaaagggtaccgattgtagggcgagtaacaatggatcagttc
atgattcatcttccttgtgaagtgccgcttggtacgaaagttacgcttattggaaggcag
ggagatgagtatattagcgctacagaggttgcggaatattcagggactattaattatgaa
attattgcaacgatcagtttccgtgtgccaagaatatttatacggaatggtaaggttgta
gagataattaattacttgaacaatatatag

DBGET integrated database retrieval system