KEGG   Bacillus thuringiensis Bt407: BTB_c10530Help
Entry
BTB_c10530        CDS       T02277                                 

Gene name
rsbW
Definition
(GenBank) serine-protein kinase RsbW
  KO
K04757  serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btg01001]
    BTB_c10530 (rsbW)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:btg03021]
    BTB_c10530 (rsbW)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BTB_c10530 (rsbW)
Protein kinases [BR:btg01001]
 Serine/threonine kinases: Other
  Bacterial family
   BTB_c10530 (rsbW)
Transcription machinery [BR:btg03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     BTB_c10530 (rsbW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_2 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AFV16748
LinkDB All DBs
Position
1023233..1023715
Genome map
AA seq 160 aa AA seqDB search
MMERFEKIEMKIPAKAEYVAIIRLTMAGVANRMGFAYDDIEDMKIAISEACTNIVQHAYK
EDVGEITIVFGLYEDRLEIMVADNGVSFDFNNLKRKVGPYDISKPVEHLPENGLGLYLIN
TLMDDIQIMHDEGMTVLMTKYIQREQVENDGNPISTYNSY
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatggagagatttgaaaagatagaaatgaaaattcctgcaaaggcagaatatgtggct
attattcgtttaacaatggctggtgttgcgaatcgaatgggctttgcttatgacgatata
gaagatatgaaaattgctattagtgaggcgtgtacaaacattgtacaacatgcatacaaa
gaagacgttggagaaattacaattgtctttgggctatatgaagatcgattagaaattatg
gttgcggataatggggttagctttgattttaataacttaaaaagaaaagttggtccgtat
gatattagtaaaccagtagaacatttgccggaaaatggtttaggtttatatttaatcaat
acattaatggatgatatacaaattatgcatgatgagggcatgacagttttaatgacaaaa
tatatacaaagagagcaggtggagaatgatggaaatccaatctcaacctacaactcttac
taa

DBGET integrated database retrieval system