KEGG   Bacillus thuringiensis Bt407: BTB_c14470Help
Entry
BTB_c14470        CDS       T02277                                 

Gene name
hisG
Definition
(GenBank) ATP phosphoribosyltransferase HisG
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00340  Histidine metabolism
btg01100  Metabolic pathways
btg01110  Biosynthesis of secondary metabolites
btg01230  Biosynthesis of amino acids
Module
btg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BTB_c14470 (hisG)
Enzymes [BR:btg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     BTB_c14470 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-ProteinID: AFV17141
LinkDB All DBs
Position
1396764..1397399
Genome map
AA seq 211 aa AA seqDB search
MRNIQIALTKGRLEKHVIPLFEQIGIDCSDLKNKGRKLVFQSKNTNVSFILVKAVDVATY
VEHGVADIGIVGKDILMENEKDIYEMLDLGVGICKFCVASIPTYNPKSYRKKRIATKYPH
ITSTYFHDKGEDVEIIKIEGSVEIAPLLGLADAIVDIVETGKTLQENGLIVFEEMHSISA
RMIVNKAALKTKKDEIFSIVNMMEQEILSGK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacattcaaattgcgttaacgaaaggaaggttagaaaaacatgtcattccactt
tttgagcagattggaattgattgttccgatctcaaaaataaaggtcggaagcttgtattt
caaagtaaaaatacaaatgtttcatttattttagtaaaagcggttgatgttgctacttat
gtagaacatggggtagctgatattgggatcgttggaaaagatattttaatggaaaacgag
aaagatatttatgaaatgctggatttaggagtggggatttgtaagttttgtgttgcttct
attcctacgtataatccgaagagttaccggaagaaaagaattgctacgaaatacccgcat
attacttctacttattttcatgataagggagaggatgtagaaattattaaaatagaaggt
tctgtagaaatcgctcctcttcttggattggcagatgcgattgtagatattgttgaaaca
ggaaaaacattacaagagaatggacttattgtatttgaggaaatgcactctatatcggct
cggatgattgtaaataaggcagccttaaaaactaaaaaagacgaaatattcagtatcgta
aatatgatggagcaagaaatcttatcagggaaatag

DBGET integrated database retrieval system