KEGG   Bacillus thuringiensis Bt407: BTB_c23400Help
Entry
BTB_c23400        CDS       T02277                                 

Gene name
ybdM
Definition
(GenBank) putative serine/threonine-protein kinase YbdM
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
btg  Bacillus thuringiensis Bt407
Brite
KEGG Orthology (KO) [BR:btg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:btg01001]
    BTB_c23400 (ybdM)
Enzymes [BR:btg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BTB_c23400 (ybdM)
Protein kinases [BR:btg01001]
 Serine/threonine kinases: Other
  Bacterial family
   BTB_c23400 (ybdM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kdo Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFV18028
LinkDB All DBs
Position
2247330..2248151
Genome map
AA seq 273 aa AA seqDB search
MKWRRVLALFDRPLRKNTIVAERYKIESVIGMGSYGVTYVVNDLQINRYKVLKQLRQSKQ
RYESGRKSFEQEKMILQTLNHHAIPSLYDHFIWEKKSFFVMEYMPGKNFEDYIFIDGYVY
TEREVFEILYKILEIVSVFHSEGIIHRDLRIPNILMKENQISIIDFGLAKWKGEDDERAT
TYEGEQALMREVHFRSDFYALGHFSLFLLYAGYESNEKKEKPWYEELTLENYNREMLMRM
LQIKTPYYENVQDLKQDVASALERMETPCFKSF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggcgtcgtgtactagctttatttgatagaccactgcgaaaaaatacaattgtt
gcagaacgttataaaattgaatcagtaattggaatgggcagttatggggttacatatgtc
gttaatgatttacaaataaatagatataaagtcttaaaacaattaagacaaagtaaacaa
agatatgagtctggtagaaaatcatttgaacaagagaaaatgattttacaaacattgaat
catcatgcaattcctagtctatatgatcatttcatatgggagaaaaagagcttctttgta
atggagtacatgcctggtaaaaattttgaagattatattttcatagatgggtatgtatat
acagaacgtgaagtttttgagattttatataaaatattagaaattgtatcggtgtttcat
agtgaaggcattattcatcgagatttacgcattccaaacatactaatgaaagaaaatcaa
attagtattattgattttggattggctaaatggaaaggtgaggatgatgagcgagctaca
acttacgaaggtgaacaagctttgatgcgagaagttcactttcgtagtgacttttatgcg
ctcggtcatttctcattatttttattatatgcaggatatgaatctaatgaaaaaaaggaa
aaaccatggtacgaagaattaactttggaaaattataatcgcgaaatgcttatgcgaatg
ttacaaataaaaacgccgtactatgagaatgtacaagatttaaaacaagatgtagcttct
gctttagagaggatggagactccatgtttcaaaagtttttag

DBGET integrated database retrieval system