KEGG   Bacillus thuringiensis Bt407: BTB_c26640Help
Entry
BTB_c26640        CDS       T02277                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
btg  Bacillus thuringiensis Bt407
Pathway
btg00473  D-Alanine metabolism
btg00550  Peptidoglycan biosynthesis
btg01100  Metabolic pathways
btg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BTB_c26640 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTB_c26640 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BTB_c26640 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btg01011]
    BTB_c26640 (ddlA)
Enzymes [BR:btg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BTB_c26640 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:btg01011]
 Precursor biosynthesis
  Amino acid ligase
   BTB_c26640 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A RimK CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFV18348
LinkDB All DBs
Position
2601109..2602023
Genome map
AA seq 304 aa AA seqDB search
MKIGVIMGGVSSEKQVSIMTGNEMIAHLDKNKYEIVPITLNEKMDLIEKAKDIDFALLAL
HGKYGEDGTVQGTLESLGIPYSGSNMLSSSICMDKNISKKILRYEGVETPDWIELTKMED
LNLDELDKLGFPLVVKPNSGGSSVGVKIVYNKNELISMLETVFEWDSEVVIEKYIKGDEI
TCSILDGKQLPIVSIRHAAEFFDYNAKYDDTSTVEEVIELPAEINERVNKASLACYKALK
CSVYARVDMMVKDGIPYVMEINTLPGMTQSSLLPKSAEAAGISYSKLLDMIIETSLKVRN
EEGF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtgttattatgggcggggtatcgtctgaaaaacaagtttcaattatgacc
gggaatgaaatgattgctcatttagataaaaataagtatgaaatagtcccaattacatta
aatgaaaaaatggatttaattgaaaaagcgaaagacattgactttgcattgctcgcatta
cacggaaaatacggagaagatgggacagttcaaggaacactggagagtttagggattcct
tatagcggaagtaatatgttatctagtagtatatgtatggataaaaatatttcgaaaaag
attttacgttatgaaggtgtagaaacaccagattggattgaacttacaaaaatggaggat
ctaaatcttgatgagttagataagttaggatttccattagtggtaaaaccaaactccggc
ggatcgagtgtcggggtgaaaatcgtttacaataaaaatgaattgatctcaatgctagaa
actgtattcgaatgggattctgaagtagtaattgagaagtatataaaaggtgatgaaatt
acatgttctattctggatggaaaacagttacctatagtttcaattcgacatgcagccgag
ttttttgattacaatgcaaaatatgatgatactagtacagttgaggaagttatcgaactt
ccagcagaaattaatgaacgtgtaaataaagcttcactggcttgttataaagcattaaaa
tgtagtgtttatgcaagagttgatatgatggtgaaggacggaattccatatgtaatggaa
attaatacattaccagggatgacacaatcaagcctattgcccaaaagtgcagaagcagcg
ggaattagttatagcaaactattagatatgattattgaaacatcattaaaagttagaaat
gaagaagggttttaa

DBGET integrated database retrieval system